DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp2 and Foxk1

DIOPT Version :9

Sequence 1:NP_476834.1 Gene:slp2 / 33608 FlyBaseID:FBgn0004567 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_001032296.2 Gene:Foxk1 / 304298 RGDID:1309643 Length:719 Species:Rattus norvegicus


Alignment Length:360 Identity:110/360 - (30%)
Similarity:165/360 - (45%) Gaps:55/360 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 PESDL-DVTSMSPAP---VANPNE--SDP---DEVDEEFVE---EDIECDGETTDGDAENKSNDG 169
            ||.|| .:.|..|:|   ::.||.  :.|   ......||:   .|::...|.....|..:..|.
  Rat   216 PEPDLRSLVSPIPSPTGTISVPNSCPASPRGAGSSSYRFVQNVTSDLQLAAEFAAKAASEQQADT 280

  Fly   170 KPVKDKKGNEKPPYSYNALIMMAIRQSSEKRLTLNGIYEYIMTNHPYYRDNKQGWQNSIRHNLSL 234
            ......|...||||||..||:.||..:.:::|||:|||.:|..::||||...:||||||||||||
  Rat   281 SGGDSPKDESKPPYSYAQLIVQAISSAQDRQLTLSGIYAHITKHYPYYRTADKGWQNSIRHNLSL 345

  Fly   235 NKCFVKVPRHYDDPGKGNYWMLDPSAEDVFIGGSTGKLRRRTTAASRSRLA--AFKRSLIGPMFP 297
            |:.|:||||..::||||::|.:||::|...:..:..|.|:|..:..|:...  :.:.:...|..|
  Rat   346 NRYFIKVPRSQEEPGKGSFWRIDPASEAKLVEQAFRKRRQRGVSCFRTPFGPLSSRSAPASPTHP 410

  Fly   298 GLAA-----------YPQFGQFLTYPPTAPSLLASMYQ-RYNPFAPKGGPGHPGLPPGLPGLPGP 350
            ||.:           ..:.|..:.:.|...|.|||:.: ||:..|| |.|  ....|.:..:|  
  Rat   411 GLMSPRSSGLQTPECLSREGSPIPHDPDLGSKLASVPEYRYSQSAP-GSP--VSAQPVIMAVP-- 470

  Fly   351 PGPQGPPGPPPPPFVAPPTSSELYQRLQYQQ----LLH--QHAAAAALAAHQRQLSVAAASA--- 406
                    |.|...||.|.:......:..||    .:|  |.|....:.   |.::.:|.||   
  Rat   471 --------PRPSNLVAKPVAYMPASIVTSQQPSGHAIHVVQQAPTVTMV---RVVTTSANSANGY 524

  Fly   407 --ASQPPPTHHHPHLAVGQAPLSPGGDSPGPSPQP 439
              |||......|.  ..|.|.|..|.::.|...:|
  Rat   525 ILASQGSTATSHD--TAGTAVLDLGNEARGLEEKP 557

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp2NP_476834.1 Forkhead 180..265 CDD:306709 47/84 (56%)
Foxk1NP_001032296.2 FHA <88..190 CDD:224630
FHA 96..189 CDD:238017
Forkhead 291..377 CDD:278670 47/85 (55%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.