DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp2 and foxa2

DIOPT Version :9

Sequence 1:NP_476834.1 Gene:slp2 / 33608 FlyBaseID:FBgn0004567 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_571024.1 Gene:foxa2 / 30126 ZFINID:ZDB-GENE-980526-404 Length:409 Species:Danio rerio


Alignment Length:262 Identity:88/262 - (33%)
Similarity:114/262 - (43%) Gaps:63/262 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 NKSNDGKPVKDKKGNEKPPYSYNALIMMAIRQSSEKRLTLNGIYEYIMTNHPYYRDNKQGWQNSI 228
            |:|.|.|..:....:.||||||.:||.|||:||..|.|||:.||::||...|:||.|:|.|||||
Zfish   135 NRSRDPKTYRRSYTHAKPPYSYISLITMAIQQSPSKMLTLSEIYQWIMDLFPFYRQNQQRWQNSI 199

  Fly   229 RHNLSLNKCFVKVPRHYDDPGKGNYWMLDPSAEDVFIGGSTGKLRRRTTAASRSRLAAFKRSLIG 293
            ||:||.|.||:||||..|.||||::|.|.|.:.::|..|.  .|||      :.|....|:    
Zfish   200 RHSLSFNDCFLKVPRSPDKPGKGSFWTLHPDSGNMFENGC--YLRR------QKRFKCDKK---- 252

  Fly   294 PMFPGLAAYPQFGQFLTYPP---TAPSLLASMYQRYN-PFAPKGGPGHPGLPPGLPGLPGPPGPQ 354
                           |:..|   |:.....|..:..| ..:|........|...|..:....|..
Zfish   253 ---------------LSKDPSRKTSEGGSNSSSESCNGNESPHSNSSSNELKRSLSDMKSGQGLS 302

  Fly   355 GPPGPPPPPFVAPPTSSELYQRLQYQQLLHQHAAAAALAAHQRQLSVAAASAASQPPPTHH---- 415
                   |...|.|||       |.|.||.||.:..|...|.:              |.||    
Zfish   303 -------PDHAASPTS-------QAQHLLAQHHSVLAHEGHLK--------------PEHHYSFN 339

  Fly   416 HP 417
            ||
Zfish   340 HP 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp2NP_476834.1 Forkhead 180..265 CDD:306709 50/84 (60%)
foxa2NP_571024.1 Forkhead_N 18..150 CDD:254796 4/14 (29%)
FH 151..239 CDD:214627 51/87 (59%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 250..315 16/97 (16%)
HNF_C 340..398 CDD:286443 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.