DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp2 and Foxh1

DIOPT Version :9

Sequence 1:NP_476834.1 Gene:slp2 / 33608 FlyBaseID:FBgn0004567 Length:451 Species:Drosophila melanogaster
Sequence 2:XP_008763787.1 Gene:Foxh1 / 300054 RGDID:1311275 Length:416 Species:Rattus norvegicus


Alignment Length:387 Identity:91/387 - (23%)
Similarity:136/387 - (35%) Gaps:136/387 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 PNHNNNNLNTTNWGSPEDHEAESDPESDLDVTSMSPAPVANPNESDPDEVDEEFVEEDIECDGET 157
            |.|.|:....  |.......:..|..|....|::||            ::.:...:..|.|.|..
  Rat    14 PFHQNDKERA--WPPCPSMASGWDLASTYSPTTLSP------------QLVQALAQGYIPCMGPL 64

  Fly   158 TDG-----DAENKSNDGKPVKDKK---GNEKPPYSYNALIMMAIRQSSEKRLTLNGIYEYIMTNH 214
            .:.     :||:.|.  .|.:.||   .::||||:|.|:|.:.|||              :....
  Rat    65 DNSQLRPPEAESLSK--TPKRRKKRYLRHDKPPYTYLAMIALIIRQ--------------VQAVF 113

  Fly   215 PYYRDNKQGWQNSIRHNLSLNKCFVKVPRHYDDP----GKGNYWMLDPS---AEDVFIGGSTGKL 272
            |::||:.:||::|||||||.|:||.|||:   ||    .|||:|.:|.|   ||         .|
  Rat   114 PFFRDDYEGWKDSIRHNLSSNRCFRKVPK---DPAKPQAKGNFWAVDVSLIPAE---------AL 166

  Fly   273 RRRTTA-----ASRSRLAAFKRSLIGPMFPGLAAYPQFGQFLTYPPTAPSLLASMYQRYNPFAPK 332
            |.:.||     .:|....||.:.        |:.|...||                         
  Rat   167 RLQNTALCRRWQNRGTHRAFAKD--------LSPYVLHGQ------------------------- 198

  Fly   333 GGPGHPGLPPGLPGLPGPPGPQGPPGPPPP--------PFVAPPTSSELYQRLQYQQLLHQHAAA 389
                                |..||.||||        ..:..|..:..:.  |:.:|..|...|
  Rat   199 --------------------PYRPPSPPPPSREDFSIKSLLGDPGKASTWP--QHPRLAGQSTPA 241

  Fly   390 AALAAHQRQLSVAAASA----------ASQPPPTHHHPHLAVGQAPLSPGGDSPGPSPQPLH 441
            .|....:.:..:.|..:          :|.|.||......:.|:. :.|...|......|||
  Rat   242 QASTLSKGEEGIGAGPSNVSDKPLWPLSSLPRPTRIEGETSQGEV-IRPSPVSSDQGSWPLH 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp2NP_476834.1 Forkhead 180..265 CDD:306709 38/91 (42%)
Foxh1XP_008763787.1 FH 93..157 CDD:294049 34/80 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.