DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp2 and FOXB1

DIOPT Version :9

Sequence 1:NP_476834.1 Gene:slp2 / 33608 FlyBaseID:FBgn0004567 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_036314.2 Gene:FOXB1 / 27023 HGNCID:3799 Length:325 Species:Homo sapiens


Alignment Length:299 Identity:92/299 - (30%)
Similarity:116/299 - (38%) Gaps:100/299 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 KPVKDKKGNEKPPYSYNALIMMAIRQSSEKRLTLNGIYEYIMTNHPYYRDNKQGWQNSIRHNLSL 234
            :|.::...::||||||.:|..|||:.|.||.|.|:.||::||...||||:|.|.||||:|||||.
Human     3 RPGRNTYSDQKPPYSYISLTAMAIQSSPEKMLPLSEIYKFIMDRFPYYRENTQRWQNSLRHNLSF 67

  Fly   235 NKCFVKVPRHYDDPGKGNYWMLDPSAEDVFIGGS------------------------------T 269
            |.||:|:||..|.||||::|.|.||..|:|..||                              .
Human    68 NDCFIKIPRRPDQPGKGSFWALHPSCGDMFENGSFLRRRKRFKVLKSDHLAPSKPADAAQYLQQQ 132

  Fly   270 GKLRRRTTAASRSRL----------------AAFKRSL-----------------IGPMFPGLAA 301
            .|||....|||.:.|                :.||...                 ...|.|..||
Human   133 AKLRLSALAASGTHLPQMPAAAYNLGGVAQPSGFKHPFAIENIIAREYKMPGGLAFSAMQPVPAA 197

  Fly   302 YPQFGQFLT--------YP-----------PTAPSLLASMYQRY----NPFAPKGGPGHPGLP-- 341
            ||...|..|        :|           .|..|:.:..|..|    .|.....|...|.:|  
Human   198 YPLPNQLTTMGSSLGTGWPHVYGSAGMIDSATPISMASGDYSAYGVPLKPLCHAAGQTLPAIPVP 262

  Fly   342 --------PGLPGLPGPPGPQGPPGPPPPPFVAPPTSSE 372
                    |.||.||.|........||.    ..||||:
Human   263 IKPTPAAVPALPALPAPIPTLLSNSPPS----LSPTSSQ 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp2NP_476834.1 Forkhead 180..265 CDD:306709 50/84 (60%)
FOXB1NP_036314.2 FH_FOXB2 1..110 CDD:410817 54/106 (51%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 284..325 6/18 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.