DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp2 and Foxi2

DIOPT Version :9

Sequence 1:NP_476834.1 Gene:slp2 / 33608 FlyBaseID:FBgn0004567 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_899016.2 Gene:Foxi2 / 270004 MGIID:3028075 Length:311 Species:Mus musculus


Alignment Length:287 Identity:98/287 - (34%)
Similarity:135/287 - (47%) Gaps:37/287 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 PPNHNNNNLNTTN--WGSPEDHEAESDPESDLDVTSMSPAPVANPNESDPDEVDEEFVEED--IE 152
            ||::...:|::..  |               ::..::||||.|......|...........  :.
Mouse    24 PPSYGRTDLSSGRRLW---------------VNSAALSPAPYATGPGPAPSYAAATLAVPGSLLG 73

  Fly   153 CDGETTDGDAENKSNDGKPVKDKKGNEKPPYSYNALIMMAIRQSSEKRLTLNGIYEYIMTNHPYY 217
            ..|.....|....|..|:  ::.....:|||||:|||.|||:.:..:||||:.||:|:..|.|:|
Mouse    74 ASGGLAGADLAWLSLSGQ--QELLRLVRPPYSYSALIAMAIQSAPLRRLTLSQIYQYVAGNFPFY 136

  Fly   218 RDNKQGWQNSIRHNLSLNKCFVKVPRHYDDPGKGNYWMLDPSAEDVFIGGSTGKLRRRTTAASRS 282
            :.:|.|||||||||||||.||.||||..:||||||||.|||:.|.:|..|:..:.|||....|.:
Mouse   137 KRSKAGWQNSIRHNLSLNDCFKKVPRDENDPGKGNYWTLDPNCEKMFDNGNFRRKRRRRGETSEA 201

  Fly   283 RLAAFKRSLIGPMFP-GLAAYPQFGQFLTYPPTAPSLLASMYQRYNPFAPKGGP---GHPGLPPG 343
                   ::.|...| |.|..|: |.....|.|:||...:.....:.|:...|.   |...||.|
Mouse   202 -------AVPGASSPEGTALEPR-GSTPQDPQTSPSPSEATTTCLSGFSTAMGALAGGFGALPDG 258

  Fly   344 LP---GLPGPPGPQGPPGPPPPPFVAP 367
            |.   .|..|| |......|..|..||
Mouse   259 LAHDFSLRRPP-PTAAAHSPQIPNTAP 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp2NP_476834.1 Forkhead 180..265 CDD:306709 53/84 (63%)
Foxi2NP_899016.2 Forkhead 99..184 CDD:333958 53/84 (63%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 188..237 14/56 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 263..294 8/23 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.