DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp2 and Foxl2

DIOPT Version :9

Sequence 1:NP_476834.1 Gene:slp2 / 33608 FlyBaseID:FBgn0004567 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_036150.1 Gene:Foxl2 / 26927 MGIID:1349428 Length:375 Species:Mus musculus


Alignment Length:351 Identity:128/351 - (36%)
Similarity:154/351 - (43%) Gaps:107/351 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 KSNDGKPVKDKKGN----------EKPPYSYNALIMMAIRQSSEKRLTLNGIYEYIMTNHPYYRD 219
            |..:..|....||.          :||||||.|||.||||:|:||||||:|||:||:...|:|..
Mouse    25 KEAEASPPSPGKGGGTTPEKPDPAQKPPYSYVALIAMAIRESAEKRLTLSGIYQYIIAKFPFYEK 89

  Fly   220 NKQGWQNSIRHNLSLNKCFVKVPRHYDDPGKGNYWMLDPSAEDVFIGGSTGKLRRRTTAASRSRL 284
            ||:|||||||||||||:||:||||......|||||.|||:.||:|..|:. :.|||.....|...
Mouse    90 NKKGWQNSIRHNLSLNECFIKVPREGGGERKGNYWTLDPACEDMFEKGNY-RRRRRMKRPFRPPP 153

  Fly   285 AAFK--RSLIGP-------MFPGLAA----------YPQFGQFL--TYP--------PTAPSLLA 320
            |.|:  :.|.|.       ..||..|          |.|.| ||  ::|        |.|...:|
Mouse   154 AHFQPGKGLFGSGGAAGGCGVPGAGADGYGYLAPPKYLQSG-FLNNSWPLPQPPSPMPYASCQMA 217

  Fly   321 SMYQRYNPFAPKGGPGHPG-------------------------LPPGL----PGLPGPPGPQGP 356
            :........|...|||.||                         ||||:    .||.|||.  .|
Mouse   218 AAAAAAAAAAAAAGPGSPGAAAVVKGLAGPAASYGPYSRVQSMALPPGVVNSYNGLGGPPA--AP 280

  Fly   357 PGPPPPPFVAPPTSSELYQRLQYQQLLHQHAAAAALAAHQRQLSVAAASAASQPPPTHHHPHLAV 421
            |.|||||...|           :....|.|||||                   |||...|...|.
Mouse   281 PPPPPPPHPHP-----------HPHAHHLHAAAA-------------------PPPAPPHHGAAA 315

  Fly   422 ---GQ-APLSPGGDSPGPSPQPLHKP 443
               || :|.||...:| |:|.|...|
Mouse   316 PPPGQLSPASPATAAP-PAPAPTSAP 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp2NP_476834.1 Forkhead 180..265 CDD:306709 58/84 (69%)
Foxl2NP_036150.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..50 4/24 (17%)
FH 50..138 CDD:214627 59/87 (68%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 272..341 34/102 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.