DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp2 and mei4

DIOPT Version :9

Sequence 1:NP_476834.1 Gene:slp2 / 33608 FlyBaseID:FBgn0004567 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_595617.1 Gene:mei4 / 2540241 PomBaseID:SPBC32H8.11 Length:517 Species:Schizosaccharomyces pombe


Alignment Length:212 Identity:71/212 - (33%)
Similarity:97/212 - (45%) Gaps:39/212 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 EAESDPESDLDVTSMSPAPVANPNESDPDEVDEEFVEEDIECDGETTDGDAENKSNDGKPVK--- 173
            ||...|:..:...|:..:...|    |...|.....:|..|.:....:.:.||.|:|.  ::   
pombe     9 EAHGKPKKVILSLSLKESSKIN----DSQNVSNVSSKEKCETEALLREENKENLSSDS--IRQMI 67

  Fly   174 ---DKKG----NEKPPYSYNALIMMAIRQSSEKRLTLNGIYEYIMTNHPYYRDNKQGWQNSIRHN 231
               :..|    .||||.||..||.:||.||..|:|||:|||.:|.....||.::..|||||||||
pombe    68 FGDEMAGFVDTGEKPPCSYATLIGLAILQSHNKQLTLSGIYTWIRNTFRYYLNHDGGWQNSIRHN 132

  Fly   232 LSLNKCFVKVPRHYDDPGKGNYWMLDPSAEDVFIG---------GSTGK---------LRRRTT- 277
            |||||.|:||.:......||:||.:||.....|:.         .|..|         ::..|| 
pombe   133 LSLNKAFIKVEKPKGKTLKGHYWTIDPDHMQNFVSVRLHRSHSTDSNSKKRPSSKCHEIKPLTTR 197

  Fly   278 ----AASRSRLAAFKRS 290
                |..||||.:|..|
pombe   198 EIPLARKRSRLNSFNSS 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp2NP_476834.1 Forkhead 180..265 CDD:306709 44/84 (52%)
mei4NP_595617.1 COG5025 1..517 CDD:227358 71/212 (33%)
Forkhead 81..167 CDD:278670 45/85 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 104 1.000 Domainoid score I1720
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 1 1.000 - - otm47190
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.