DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp2 and Foxi2

DIOPT Version :9

Sequence 1:NP_476834.1 Gene:slp2 / 33608 FlyBaseID:FBgn0004567 Length:451 Species:Drosophila melanogaster
Sequence 2:XP_341950.2 Gene:Foxi2 / 246073 RGDID:621739 Length:337 Species:Rattus norvegicus


Alignment Length:201 Identity:88/201 - (43%)
Similarity:107/201 - (53%) Gaps:30/201 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 KPPYSYNALIMMAIRQSSEKRLTLNGIYEYIMTNHPYYRDNKQGWQNSIRHNLSLNKCFVKVPRH 244
            :|||||:|||.|||:.:..:||||:.||:|:..|.|:|:.:|.|||||||||||||.||.||||.
  Rat   125 RPPYSYSALIAMAIQSAPLRRLTLSQIYQYVAGNFPFYKRSKAGWQNSIRHNLSLNDCFKKVPRD 189

  Fly   245 YDDPGKGNYWMLDPSAEDVFIGGSTGKLRRR--------TTAASRSRLAAFKRSLIGPMFPGLAA 301
            .:||||||||.|||:.|.:|..|:..:.|||        ...|||...||.:.|  |.:...|..
  Rat   190 ENDPGKGNYWTLDPNCEKMFDNGNFRRKRRRRGETSEAAVPGASRPERAALEPS--GLVSQDLQT 252

  Fly   302 YPQFGQFLTYPPTAPSLLASMYQRYNPFAPKGGPGHPGLPPGLP---GLPGPP-----GPQGP-- 356
            .|.        ||||...|.:...........| |...||.|||   .|..||     .||.|  
  Rat   253 SPS--------PTAPEAAACLSSFSTALGALAG-GFSTLPDGLPQDFSLRRPPTESSRRPQIPNT 308

  Fly   357 -PGPPP 361
             ||..|
  Rat   309 SPGFGP 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp2NP_476834.1 Forkhead 180..265 CDD:306709 53/84 (63%)
Foxi2XP_341950.2 Forkhead 125..211 CDD:278670 54/85 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.