DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp2 and FOXS1

DIOPT Version :9

Sequence 1:NP_476834.1 Gene:slp2 / 33608 FlyBaseID:FBgn0004567 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_004109.1 Gene:FOXS1 / 2307 HGNCID:3735 Length:330 Species:Homo sapiens


Alignment Length:314 Identity:109/314 - (34%)
Similarity:138/314 - (43%) Gaps:69/314 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 KPPYSYNALIMMAIRQSSEKRLTLNGIYEYIMTNHPYYRDNKQGWQNSIRHNLSLNKCFVKVPRH 244
            ||||||.|||.|||:.|..:|.||:|||.|||....:||.|:.|||||||||||||:|||||||.
Human    18 KPPYSYIALIAMAIQSSPGQRATLSGIYRYIMGRFAFYRHNRPGWQNSIRHNLSLNECFVKVPRD 82

  Fly   245 YDDPGKGNYWMLDPSAEDVFIGGSTGKLRRR---------TTAASRSRLAAFKRSLIGPMFPGLA 300
            ...||||:||.|||...|:|..||..:.|||         |...:::|....:.:...|..|...
Human    83 DRKPGKGSYWTLDPDCHDMFEHGSFLRRRRRFTRQTGAEGTRGPAKARRGPLRATSQDPGVPNAT 147

  Fly   301 AYPQFGQFLTYPPTAP--------SLLASMYQRYNPFAPKGGPGHPGLP-------PGLPG-LPG 349
            .    |:..::||..|        .|:.:|.....|....|.|..|..|       |..|| ||.
Human   148 T----GRQCSFPPELPDPKGLSFGGLVGAMPASMCPATTDGRPRPPMEPKEISTPKPACPGELPV 208

  Fly   350 PPGPQGPP--GPP------------PPPFVAPPTS-SELYQ-RLQYQQLLHQHAAAAALAAHQRQ 398
            .......|  |.|            |.|.::|.:. ...|| |||        |....:.|....
Human   209 ATSSSSCPAFGFPAGFSEAESFNKAPTPVLSPESGIGSSYQCRLQ--------ALNFCMGADPGL 265

  Fly   399 LSVAAASAASQPPPT--------------HHHPHLAVGQAPLSPGGDSP-GPSP 437
            ..:.|::|.|..|||              |..|.:| |..|:..|...| |.:|
Human   266 EHLLASAAPSPAPPTPPGSLRAPLPLPTDHKEPWVA-GGFPVQGGSGYPLGLTP 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp2NP_476834.1 Forkhead 180..265 CDD:306709 55/84 (65%)
FOXS1NP_004109.1 Forkhead 18..103 CDD:306709 55/84 (65%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 111..157 9/49 (18%)
DNA_pol3_gamma3 <116..313 CDD:331207 45/209 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 179..200 5/20 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.