DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp2 and FOXC2

DIOPT Version :9

Sequence 1:NP_476834.1 Gene:slp2 / 33608 FlyBaseID:FBgn0004567 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_005242.1 Gene:FOXC2 / 2303 HGNCID:3801 Length:501 Species:Homo sapiens


Alignment Length:356 Identity:121/356 - (33%)
Similarity:152/356 - (42%) Gaps:109/356 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 KPPYSYNALIMMAIRQSSEKRLTLNGIYEYIMTNHPYYRDNKQGWQNSIRHNLSLNKCFVKVPRH 244
            ||||||.|||.|||:.:.||::||||||::||...|:||:||||||||||||||||:|||||||.
Human    72 KPPYSYIALITMAIQNAPEKKITLNGIYQFIMDRFPFYRENKQGWQNSIRHNLSLNECFVKVPRD 136

  Fly   245 YDDPGKGNYWMLDPSAEDVFIGGSTGKLRRR----TTAASRSRLAAFKR-----SLIGPMFPGLA 300
            ...||||:||.|||.:.::|..||..:.|||    ..:..:...|..|.     |...|..|.||
Human   137 DKKPGKGSYWTLDPDSYNMFENGSFLRRRRRFKKKDVSKEKEERAHLKEPPPAASKGAPATPHLA 201

  Fly   301 AYPQFGQ---FLTYPPTAPSL-LASMYQRYNP------------FAPKGGPG------HPGLPPG 343
            ..|:..:   .:.....:|:| :.:..:..:|            ..|.|.|.      |...|.|
Human   202 DAPKEAEKKVVIKSEAASPALPVITKVETLSPESALQGSPRSAASTPAGSPDGSLPEHHAAAPNG 266

  Fly   344 LPGL---------PGPPGPQGPPGP-------PP---PPFVAPPTSSELYQRLQYQQLLHQHAAA 389
            |||.         ..|||.:..||.       ||   |...|||.:        |.|...|...|
Human   267 LPGFSVENIMTLRTSPPGGELSPGAGRAGLVVPPLALPYAAAPPAA--------YGQPCAQGLEA 323

  Fly   390 AALAAHQ---RQLSV--------------AAASAASQPP--PT---------------------- 413
            .|...:|   |.:|:              |...|.|..|  ||                      
Human   324 GAAGGYQCSMRAMSLYTGAERPAHMCVPPALDEALSDHPSGPTSPLSALNLAAGQEGALAATGHH 388

  Fly   414 -----HHHPHLAVGQAPLSPGGDSPGPSPQP 439
                 ||||     |||..|....|.|:|||
Human   389 HQHHGHHHP-----QAPPPPPAPQPQPTPQP 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp2NP_476834.1 Forkhead 180..265 CDD:306709 57/84 (68%)
FOXC2NP_005242.1 FH 72..160 CDD:214627 58/87 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 167..208 9/40 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 232..268 7/35 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 383..420 13/37 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.