DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp2 and FOXL1

DIOPT Version :9

Sequence 1:NP_476834.1 Gene:slp2 / 33608 FlyBaseID:FBgn0004567 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_005241.1 Gene:FOXL1 / 2300 HGNCID:3817 Length:345 Species:Homo sapiens


Alignment Length:276 Identity:108/276 - (39%)
Similarity:129/276 - (46%) Gaps:75/276 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 EKPPYSYNALIMMAIRQSSEKRLTLNGIYEYIMTNHPYYRDNKQGWQNSIRHNLSLNKCFVKVPR 243
            :||||||.|||.|||:.:.|:|:||||||::||...|:|.||:||||||||||||||.|||||||
Human    48 QKPPYSYIALIAMAIQDAPEQRVTLNGIYQFIMDRFPFYHDNRQGWQNSIRHNLSLNDCFVKVPR 112

  Fly   244 HYDDPGKGNYWMLDPSAEDVFIGGSTGKLRRRTTAASRSRLAAFKRSLIGPMFPGLAAYPQFGQF 308
            ....||||:||.|||...|:|   ..|..|||            ||.   |. ||..|       
Human   113 EKGRPGKGSYWTLDPRCLDMF---ENGNYRRR------------KRK---PK-PGPGA------- 151

  Fly   309 LTYPPTAPSLLASMYQRYNPFAPKGGPGHPGLPPGLPGLPGPPGPQGP--PGP-PPPPFVAPPTS 370
                |.|....|..:||.....|:.|.|..|..|.:..|...|....|  .|| ||.|...|.|:
Human   152 ----PEAKRPRAETHQRSAEAQPEAGSGAGGSGPAISRLQAAPAGPSPLLDGPSPPAPLHWPGTA 212

  Fly   371 SELYQRLQYQQLLHQHAAAAALAAHQRQLSVAAASAASQPPPTHHHPHLAVGQAPLSPGGDSPGP 435
            |.           ::.|..||..|           ||           :|||||..:  ||.|| 
Human   213 SP-----------NEDAGDAAQGA-----------AA-----------VAVGQAART--GDGPG- 241

  Fly   436 SPQPLHKPVTVVSRNS 451
                  .|:...||:|
Human   242 ------SPLRPASRSS 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp2NP_476834.1 Forkhead 180..265 CDD:306709 57/84 (68%)
FOXL1NP_005241.1 FH 49..137 CDD:214627 58/90 (64%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 136..289 50/185 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.