DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp2 and FOXI1

DIOPT Version :9

Sequence 1:NP_476834.1 Gene:slp2 / 33608 FlyBaseID:FBgn0004567 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_036320.2 Gene:FOXI1 / 2299 HGNCID:3815 Length:378 Species:Homo sapiens


Alignment Length:286 Identity:98/286 - (34%)
Similarity:126/286 - (44%) Gaps:90/286 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 KPPYSYNALIMMAIRQSSEKRLTLNGIYEYIMTNHPYYRDNKQGWQNSIRHNLSLNKCFVKVPRH 244
            :|||||:|||.|||..:.:|||||:.||:|:..|.|:|..:|.|||||||||||||.||.||||.
Human   123 RPPYSYSALIAMAIHGAPDKRLTLSQIYQYVADNFPFYNKSKAGWQNSIRHNLSLNDCFKKVPRD 187

  Fly   245 YDDPGKGNYWMLDPSAEDVFIGGSTGKLRRRTT--AASRSRLAAFKRSLIGPMFPGLAAYPQFGQ 307
            .|||||||||.|||:.|.:|..|:..:.|:|.:  ::|.:.||..|.....|:.......||   
Human   188 EDDPGKGNYWTLDPNCEKMFDNGNFRRKRKRKSDVSSSTASLALEKTESSLPVDSPKTTEPQ--- 249

  Fly   308 FLTYPPTAPSLLASMYQRYNPFAPKGGPGHPGLPPGLPGLPGPPGPQGPPGPPPPPFVAPPTSSE 372
                     .:|                  .|..||  |....|..:    |.|||..||..:|.
Human   250 ---------DIL------------------DGASPG--GTTSSPEKR----PSPPPSGAPCLNSF 281

  Fly   373 LYQRLQYQQLLHQHAAAAALAAHQRQLSVAAASAASQPPPTHHHPHLAVGQAPLSPGGDSPGPSP 437
            |.....|                     |:..|      ||.|         ||.    :||.||
Human   282 LSSMTAY---------------------VSGGS------PTSH---------PLV----TPGLSP 306

  Fly   438 QPLHK------------PVTVVSRNS 451
            :|..|            |:|.:|.:|
Human   307 EPSDKTGQNSLTFNSFSPLTNLSNHS 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp2NP_476834.1 Forkhead 180..265 CDD:306709 55/84 (65%)
FOXI1NP_036320.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26
FH 123..211 CDD:214627 56/87 (64%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 208..278 22/105 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.