DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp2 and FOXF1

DIOPT Version :9

Sequence 1:NP_476834.1 Gene:slp2 / 33608 FlyBaseID:FBgn0004567 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_001442.2 Gene:FOXF1 / 2294 HGNCID:3809 Length:379 Species:Homo sapiens


Alignment Length:334 Identity:107/334 - (32%)
Similarity:145/334 - (43%) Gaps:94/334 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 GDAENKSNDGKPVKDKKGN------EKPPYSYNALIMMAIRQSSEKRLTLNGIYEYIMTNHPYYR 218
            |.|.:.::.| |.|.||.|      |||||||.|||:|||:.|..|||||:.||:::.:..|::|
Human    23 GAAMDPASSG-PSKAKKTNAGIRRPEKPPYSYIALIVMAIQSSPTKRLTLSEIYQFLQSRFPFFR 86

  Fly   219 DNKQGWQNSIRHNLSLNKCFVKVPRHYDDPGKGNYWMLDPSAEDVFIGGSTGKLRRRTTAASRSR 283
            .:.|||:||:|||||||:||:|:|:....||||:||.:||::|.:|   ..|..|||.....|  
Human    87 GSYQGWKNSVRHNLSLNECFIKLPKGLGRPGKGHYWTIDPASEFMF---EEGSFRRRPRGFRR-- 146

  Fly   284 LAAFKRSLIGPMFP-----GLAAYPQFGQF------LTYPPTAPSLLASMYQRYNPFAPKGG--- 334
                |...:.||:.     |....|....|      |:.||             |..|.:||   
Human   147 ----KCQALKPMYSMMNGLGFNHLPDTYGFQGSAGGLSCPP-------------NSLALEGGLGM 194

  Fly   335 -PGH-PGLPPGL-------PGLPGPPG---------------PQGPPGPPPPPFVAPPTSSELYQ 375
             .|| ||...|:       |.||...|               |......|..|.:  ||.:    
Human   195 MNGHLPGNVDGMALPSHSVPHLPSNGGHSYMGGCGGAAAGEYPHHDSSVPASPLL--PTGA---- 253

  Fly   376 RLQYQQLLHQHAA-AAALAAHQRQLSVAAASAASQPPPTHHHPHLAVGQAPLSPGGDSPGP---- 435
                ..::..||. :.:.||.....|.|..|.||.           :.|.||||...:..|    
Human   254 ----GGVMEPHAVYSGSAAAWPPSASAALNSGASY-----------IKQQPLSPCNPAANPLSGS 303

  Fly   436 -SPQPLHKP 443
             |...|.:|
Human   304 LSTHSLEQP 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp2NP_476834.1 Forkhead 180..265 CDD:306709 47/84 (56%)
FOXF1NP_001442.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..45 8/22 (36%)
FH 48..136 CDD:214627 48/90 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.