DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp2 and FOXJ3

DIOPT Version :9

Sequence 1:NP_476834.1 Gene:slp2 / 33608 FlyBaseID:FBgn0004567 Length:451 Species:Drosophila melanogaster
Sequence 2:XP_005270689.1 Gene:FOXJ3 / 22887 HGNCID:29178 Length:630 Species:Homo sapiens


Alignment Length:370 Identity:103/370 - (27%)
Similarity:143/370 - (38%) Gaps:122/370 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 NKSNDGKPVKDKKGNEKPPYSYNALIMMAIRQSSEKRLTLNGIYEYIMTNHPYYRDNKQGWQNSI 228
            |.:.|.:.|:..| :.||||||.:||..||..|.:|::||:.||::|..|.||||:...||:|||
Human    71 NTTLDQEEVQQHK-DGKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYREAGSGWKNSI 134

  Fly   229 RHNLSLNKCFVKVPRHYDDPGKGNYWMLDPS-AEDVFIGGSTGKLRRRTTAASRSRLAAFKRSL- 291
            ||||||||||:||||..||||||:||.:|.: .|||.  .:..|.|.|:...:.:..:....|| 
Human   135 RHNLSLNKCFLKVPRSKDDPGKGSYWAIDTNPKEDVL--PTRPKKRARSVERASTPYSIDSDSLG 197

  Fly   292 -----IGPMFPGLAAYPQFGQFLTY---------PPT------APSLLASM-------YQRYNPF 329
                 .|...|.||......:...|         |.:      :...|||:       ...|.|.
Human   198 MECIISGSASPTLAINTVTNKVTLYNTDQDGSDSPRSSLNNSLSDQSLASVNLNSVGSVHSYTPV 262

  Fly   330 APKGGPGHP-----GLPPGLPGLPGPPGPQGPPGPPPPPFVAPPTSSELY--------------- 374
            .     .||     .|.|                ...|.:..|....:|.               
Human   263 T-----SHPESVSQSLTP----------------QQQPQYNLPERDKQLLFSEYNFEDLSASFRS 306

  Fly   375 -------QRLQYQQLL---------------HQHAAAAALAAHQR-------------------- 397
                   |.|..|.|:               :||:.::.::.|..                    
Human   307 LYKSVFEQSLSQQGLMNIPSESSQQSHTSCTYQHSPSSTVSTHPHSNQSSLSNSHGSGLNTTGSN 371

  Fly   398 ---QLSVAAASAASQPPPTHHHPHLAVGQAPLSPGGDSPGPSPQP 439
               |:|::.....:||.|  |.||...| .|..| ..||.|:|.|
Human   372 SVAQVSLSHPQMHTQPSP--HPPHRPHG-LPQHP-QRSPHPAPHP 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp2NP_476834.1 Forkhead 180..265 CDD:306709 53/85 (62%)
FOXJ3XP_005270689.1 Forkhead 86..163 CDD:278670 49/76 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.