DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp2 and FOXD4L1

DIOPT Version :9

Sequence 1:NP_476834.1 Gene:slp2 / 33608 FlyBaseID:FBgn0004567 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_036316.1 Gene:FOXD4L1 / 200350 HGNCID:18521 Length:408 Species:Homo sapiens


Alignment Length:402 Identity:127/402 - (31%)
Similarity:158/402 - (39%) Gaps:104/402 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 LNLTNLMKMARTPH--LKSSFSINSILPETVEHHDEDEEEDVEKKSPAKFPPNHNNNNLNTTNWG 106
            :||....:...||.  |:.|...:..:....|..||||.||.|:::..||........|....||
Human     1 MNLPRAERPRSTPQRSLRDSDGEDGKIDVLGEEEDEDEVEDEEEEASQKFLEQSLQPGLQVARWG 65

  Fly   107 S---PEDHEAESDPESDLDVTSMSPAPVANPNESDPDEVDEEFVEEDIECDGETTDGDAENKSND 168
            .   |.:|.....|                   |||.|...||                ......
Human    66 GVALPREHIEGGGP-------------------SDPSEFGTEF----------------RAPPRS 95

  Fly   169 GKPVKDKKGNEKPPYSYNALIMMAIRQSSEKRLTLNGIYEYIMTNHPYYRDNKQGWQNSIRHNLS 233
            ....:|.:...||||||.|||.|||.||..|||||:||..:|....||||.....||||||||||
Human    96 AAASEDARQPAKPPYSYIALITMAILQSPHKRLTLSGICAFISGRFPYYRRKFPAWQNSIRHNLS 160

  Fly   234 LNKCFVKVPRHYDDPGKGNYWMLDPSAEDVFIGGSTGKLRRRTTAASRSRLAAFKRSLIGPMFPG 298
            ||.||||:||....||||.||.|||:::|:|..||..:.|:|           |||..:.|    
Human   161 LNDCFVKIPREPGHPGKGTYWSLDPASQDMFDNGSFLRRRKR-----------FKRHQLTP---- 210

  Fly   299 LAAYPQFGQFLTYPPTAPSLLASMYQRYNPFAPKGGP--GHPGLPPGLPGLPGPPGPQGPPGPPP 361
                   |..|.:|...|:..|:::.      |:.||  |.|.||..:||    ..|...||..|
Human   211 -------GAHLPHPFPLPAAHAALHN------PRPGPLLGAPALPQPVPG----AYPNTAPGRRP 258

  Fly   362 PPFVAPPTSSELYQRLQYQQLLHQHAAAAALAAHQRQLSVAAASAASQPPPTHHHPHLAVGQAP- 425
                              ..|||.|.        .|.|.::|.:.|..|...........|..| 
Human   259 ------------------YALLHPHP--------PRYLLLSAPAYAGAPKKAEGADLATPGTLPV 297

  Fly   426 LSPGGDSPGPSP 437
            |.|   |.||.|
Human   298 LQP---SLGPQP 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp2NP_476834.1 Forkhead 180..265 CDD:306709 54/84 (64%)
FOXD4L1NP_036316.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..54 16/52 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 71..104 9/67 (13%)
Forkhead 107..193 CDD:278670 55/85 (65%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 385..408
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.