DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp2 and Foxe3

DIOPT Version :9

Sequence 1:NP_476834.1 Gene:slp2 / 33608 FlyBaseID:FBgn0004567 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_599166.1 Gene:Foxe3 / 171302 RGDID:621727 Length:286 Species:Rattus norvegicus


Alignment Length:338 Identity:119/338 - (35%)
Similarity:150/338 - (44%) Gaps:99/338 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 SMSPAPVANPN--ESDPDEVDEEFVEEDIECDGETTDGDAENKSNDG------KPVKDKKGNEKP 181
            |:||:....|:  ..:|....||.|          ..||:|..:..|      :|:  ::|  ||
  Rat    15 SVSPSGPQPPSLAGDEPGREPEEVV----------GGGDSEPPAAPGPGRRRRRPL--QRG--KP 65

  Fly   182 PYSYNALIMMAIRQSSEKRLTLNGIYEYIMTNHPYYRDNKQGWQNSIRHNLSLNKCFVKVPRHYD 246
            ||||.|||.||:..:..:||||..||.:|.....:|||:.:.|||||||||:||.|||||||...
  Rat    66 PYSYIALIAMALAHAPGRRLTLAAIYRFITERFAFYRDSPRKWQNSIRHNLTLNDCFVKVPREPG 130

  Fly   247 DPGKGNYWMLDPSAEDVFIGGSTGKLRRRTTAASRSRLAAFKRSLIGPMFPGLAAYPQFGQFLTY 311
            :|||||||.|||:|.|:|..||..:.|:|           |||:       .|.|.|        
  Rat   131 NPGKGNYWTLDPAAADMFDNGSFLRRRKR-----------FKRT-------ELPAPP-------- 169

  Fly   312 PPTAPSLLASMYQRYNPFAPKGGPGHPGLPPG----LPGLPG----PPGPQGPPGPPP------- 361
            ||..|         |.||.|...|. |. ||.    |..|.|    ||||..|  .||       
  Rat   170 PPPFP---------YAPFPPAPAPA-PA-PPARLFRLDSLLGLQTEPPGPLAP--EPPCCAAPDA 221

  Fly   362 --PPFVA---PPTSSELYQRLQYQQLLHQHAAAAALAAHQRQLSVAAASAASQPPPTHHHPHLAV 421
              ||..|   ||..|...:||         ...|.|.| :..|::|.::.|..|        |..
  Rat   222 SFPPCAAAASPPLYSPAPERL---------GLPAPLPA-EPLLALAGSAGALGP--------LGA 268

  Fly   422 GQAPLSPGGDSPG 434
            |:|.|...|..||
  Rat   269 GEAYLRQPGFPPG 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp2NP_476834.1 Forkhead 180..265 CDD:306709 51/84 (61%)
Foxe3NP_599166.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..62 13/58 (22%)
FH 64..152 CDD:214627 52/87 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.