DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp2 and Foxa3

DIOPT Version :9

Sequence 1:NP_476834.1 Gene:slp2 / 33608 FlyBaseID:FBgn0004567 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_032286.1 Gene:Foxa3 / 15377 MGIID:1347477 Length:353 Species:Mus musculus


Alignment Length:337 Identity:100/337 - (29%)
Similarity:139/337 - (41%) Gaps:83/337 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 VEHHDEDE----EEDVEKKSPAKFPPNHN--NNNLNTTNWGSPEDHEAESDPESDLDVTSMSPAP 130
            :|.||..|    .|..|..||....|...  |:.:......||.       |...|..:.:...|
Mouse     7 MEAHDLAEWSYYPEAGEVYSPVNPVPTMAPLNSYMTLNPLSSPY-------PPGGLQASPLPTGP 64

  Fly   131 VANPNESDPDEVDEEFVEEDIECDGETTDGDAENKSNDG----------KPVKDKKGNEKPPYSY 185
            :|.|..:.|  :...|....   .|.:|.|.|......|          |..:....:.||||||
Mouse    65 LAPPAPTAP--LGPTFPSLG---TGGSTGGSASGYVAPGPGLVHGKEMAKGYRRPLAHAKPPYSY 124

  Fly   186 NALIMMAIRQSSEKRLTLNGIYEYIMTNHPYYRDNKQGWQNSIRHNLSLNKCFVKVPRHYDDPGK 250
            .:||.|||:|:..|.|||:.||::||...||||:|:|.|||||||:||.|.|||||.|..|.|||
Mouse   125 ISLITMAIQQAPGKMLTLSEIYQWIMDLFPYYRENQQRWQNSIRHSLSFNDCFVKVARSPDKPGK 189

  Fly   251 GNYWMLDPSAEDVFIGGSTGKLRRR------------TTAASRSRLAAFKRSLIGPMFPGLAAYP 303
            |:||.|.||:.::|..|...:.::|            .|:|||:..|                  
Mouse   190 GSYWALHPSSGNMFENGCYLRRQKRFKLEEKAKKGNSATSASRNGTA------------------ 236

  Fly   304 QFGQFLTYPPTAPSLLASMYQRYNPFAPKGGPGHPGLPPG--LPGLPGPPGPQGPPGPPPPPFVA 366
              |...:...||.:.:.|      |..|:..|..|....|  :.||               ...:
Mouse   237 --GSATSATTTAATAVTS------PAQPQPTPSEPEAQSGDDVGGL---------------DCAS 278

  Fly   367 PPTSSELYQRLQ 378
            ||:|:..:..|:
Mouse   279 PPSSTPYFSGLE 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp2NP_476834.1 Forkhead 180..265 CDD:306709 52/84 (62%)
Foxa3NP_032286.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 52..83 6/35 (17%)
FH 119..207 CDD:214627 53/87 (61%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 219..287 19/108 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.