DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp2 and Foxq1

DIOPT Version :9

Sequence 1:NP_476834.1 Gene:slp2 / 33608 FlyBaseID:FBgn0004567 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_032265.3 Gene:Foxq1 / 15220 MGIID:1298228 Length:400 Species:Mus musculus


Alignment Length:429 Identity:126/429 - (29%)
Similarity:157/429 - (36%) Gaps:132/429 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 HDEDEEEDVEKKSPAKFPPNHNNNNLNTTNWGSPEDHEAESDPESDLDVTSMSPA---------- 129
            |.:....|:|....:..|              ||.....:....||.|..:.|||          
Mouse    12 HGDKMGSDLEGAGSSDVP--------------SPLSAAGDDSLGSDGDCAANSPAAGSGAGDLEG 62

  Fly   130 ------PVANPNESD-PDEVDEEFVEEDI--ECDGETTDGD-AENKSNDGKPVKDKKGNEKPPYS 184
                  ....|:..| |:..|:...:...  .|.|....|: |.:|....:|        |||||
Mouse    63 GGGERNSSGGPSAQDGPEATDDSRTQASAAGPCAGGVGGGEGARSKPYTRRP--------KPPYS 119

  Fly   185 YNALIMMAIRQSSEKRLTLNGIYEYIMTNHPYYRDNKQGWQNSIRHNLSLNKCFVKVPRHYDDP- 248
            |.|||.||||.|:..||||..|.||:|...|::|.:..||:||:|||||||.|||||.|....| 
Mouse   120 YIALIAMAIRDSAGGRLTLAEINEYLMGKFPFFRGSYTGWRNSVRHNLSLNDCFVKVLRDPSRPW 184

  Fly   249 GKGNYWMLDPSAEDVFIGGSTGKLRRR---TTAASRSRLAAFKRSLIGPMFPGLAAYPQFGQFLT 310
            ||.|||||:|::|..|..|...:.|:|   .|..|.|.|    |....|  ||.|..||......
Mouse   185 GKDNYWMLNPNSEYTFADGVFRRRRKRLSHRTTVSASGL----RPEEAP--PGPAGTPQPAPAAR 243

  Fly   311 YPPTAPSLLASMYQRYNP-------FA-----------------------PKGGP------GHPG 339
            ..|.|.| .|...:|.:|       ||                       |.|..      .:|.
Mouse   244 SSPIARS-PARQEERSSPASKFSSSFAIDSILSKPFRSRRDGDSALGVQLPWGAAPCPPLRAYPA 307

  Fly   340 LPPGLPG---LP----GPPGP-----QG----PPGP----------PPPPFVAPPTSSELYQRLQ 378
            |.|..||   ||    |...|     :|    |..|          |..||..|.|         
Mouse   308 LLPAAPGGALLPLCAYGASEPTLLASRGTEVQPAAPLLLAPLSTAAPAKPFRGPET--------- 363

  Fly   379 YQQLLHQHAAAAALAAHQRQLSVAAASAASQPPPTHHHP 417
                    |.||.|....|..:...|:||..|.|...:|
Mouse   364 --------AGAAHLYCPLRLPTALQAAAACGPGPHLSYP 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp2NP_476834.1 Forkhead 180..265 CDD:306709 51/85 (60%)
Foxq1NP_032265.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..112 21/113 (19%)
FH 115..193 CDD:238016 48/77 (62%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 213..264 17/57 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.