DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp2 and Foxs1

DIOPT Version :9

Sequence 1:NP_476834.1 Gene:slp2 / 33608 FlyBaseID:FBgn0004567 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_034356.1 Gene:Foxs1 / 14239 MGIID:95546 Length:329 Species:Mus musculus


Alignment Length:318 Identity:112/318 - (35%)
Similarity:130/318 - (40%) Gaps:102/318 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 KPPYSYNALIMMAIRQSSEKRLTLNGIYEYIMTNHPYYRDNKQGWQNSIRHNLSLNKCFVKVPRH 244
            ||||||.|||.|||:.|..:|.||:|||.|||....:||.|:.|||||||||||||:|||||||.
Mouse    18 KPPYSYIALIAMAIQSSPGQRATLSGIYRYIMGRFAFYRHNRPGWQNSIRHNLSLNECFVKVPRD 82

  Fly   245 YDDPGKGNYWMLDPSAEDVFIGGSTGKLRRRTTAASRSRLAAFKRSLIGPM----FPGLAAYPQF 305
            ...||||:||.|||...|:|..||.  ||||.....|:.....|    ||:    .|..|..|. 
Mouse    83 DRKPGKGSYWTLDPDCHDMFQHGSF--LRRRRRFTKRTGAQGTK----GPVKIDHRPHRATSPD- 140

  Fly   306 GQFLTYPPTAPSLLASMYQRYNPFAPKGGPGHPGLP-PGLPG-LPG-------------PPGPQ- 354
                   |.||.....   |..|| |:..|...||. .||.| ||.             |.||: 
Mouse   141 -------PGAPKTTTG---RLCPF-PQEVPNPKGLSFEGLMGSLPANMSSTTSDVRPQLPTGPKE 194

  Fly   355 -------GP--------PGP------------------PPPPFVAPPTSSELYQ-RLQYQQLLHQ 385
                   ||        |.|                  .|.|.|||.:....|| |:|       
Mouse   195 MCSAKSGGPRELSEATSPSPCPAFGFSSAFSDAESLGKAPTPGVAPESVGSSYQCRMQ------- 252

  Fly   386 HAAAAALAAHQRQLSVAAASAASQPPPTHHHPHLAVGQAPLSPGGDSPGPS---PQPL 440
                        .|:....:....       .||.|...| :||..:|..|   |.||
Mouse   253 ------------TLNFCMGTDPGL-------EHLLVSSVP-TPGSSTPSASHRAPLPL 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp2NP_476834.1 Forkhead 180..265 CDD:306709 55/84 (65%)
Foxs1NP_034356.1 Forkhead 18..103 CDD:278670 55/84 (65%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 117..150 10/47 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 174..213 6/38 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.