DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp2 and Foxd4

DIOPT Version :9

Sequence 1:NP_476834.1 Gene:slp2 / 33608 FlyBaseID:FBgn0004567 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_032048.1 Gene:Foxd4 / 14237 MGIID:1347467 Length:444 Species:Mus musculus


Alignment Length:406 Identity:121/406 - (29%)
Similarity:154/406 - (37%) Gaps:122/406 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 PVANPNESDPDEVDEEFVEEDIECDGETTD--------------------------------GDA 162
            |..:|..||.|||:.:.:.|  |.||:.|:                                ||.
Mouse    13 PPPSPLSSDQDEVEIDVLAE--EEDGDQTEEEDDEEESHKCLERSLQRPGARTLAGRSAGDCGDL 75

  Fly   163 ENKS----------NDGKPVKDKKGNEKPPYSYNALIMMAIRQSSEKRLTLNGIYEYIMTNHPYY 217
            .|.|          .......|.....||||||.|||.|||.||..|||||:||..:|....|||
Mouse    76 SNSSGFLRKFRAPRTPATTTADGPQPAKPPYSYIALITMAILQSPHKRLTLSGICAFISGRFPYY 140

  Fly   218 RDNKQGWQNSIRHNLSLNKCFVKVPRHYDDPGKGNYWMLDPSAEDVFIGGSTGKLRRRTTAASRS 282
            |.....||||||||||||.||||:||....|||||||.|||:::|:|..||..:.|:|       
Mouse   141 RRKFPAWQNSIRHNLSLNDCFVKIPREPGHPGKGNYWSLDPASQDMFDNGSFLRRRKR------- 198

  Fly   283 RLAAFKRSLIGPMFPGLAAYPQFGQFLTYPPTA---------PSLLASMYQRYNPFAPKGGPGHP 338
                |||.     .|....:|.    ..:||.|         ||||.    ||:.........||
Mouse   199 ----FKRH-----HPPSGGHPH----CPFPPPAVPATLHVSQPSLLL----RYSAPPQPNLAAHP 246

  Fly   339 GLPP-GLPGLPGPPGPQ--------------------GPPGPPPPPFVAPPTSSELYQRLQYQQL 382
            ..|| ..|..|..|.|.                    .|..|...|.:.|...|:.::|.|....
Mouse   247 AAPPRSHPCAPLHPHPMRYLLLAAPAYGDNPRKAEGADPATPLAIPALQPVLGSQPWERDQSSGT 311

  Fly   383 LHQHAAAA-ALAAHQRQLSVAAASAASQP-------------PPTHHHP-------HLAVGQAPL 426
            ......|: .:.:..:.::.....:|..|             ||...||       |::.|...:
Mouse   312 RSGRGCASFTIESIMQGVTGGGTGSAQSPSFAPWSYCHLLQHPPCLLHPQAASPLFHMSAGSRTI 376

  Fly   427 SPGGDSPGPSPQPLHK 442
            .|  ..|.| |.||.:
Mouse   377 LP--QQPQP-PLPLQQ 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp2NP_476834.1 Forkhead 180..265 CDD:306709 55/84 (65%)
Foxd4NP_032048.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..70 12/58 (21%)
Forkhead 103..189 CDD:278670 56/85 (66%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 234..256 6/21 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.