DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp2 and Foxi1

DIOPT Version :9

Sequence 1:NP_476834.1 Gene:slp2 / 33608 FlyBaseID:FBgn0004567 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_076396.3 Gene:Foxi1 / 14233 MGIID:1096329 Length:372 Species:Mus musculus


Alignment Length:170 Identity:77/170 - (45%)
Similarity:102/170 - (60%) Gaps:30/170 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 KPPYSYNALIMMAIRQSSEKRLTLNGIYEYIMTNHPYYRDNKQGWQNSIRHNLSLNKCFVKVPRH 244
            :|||||:|||.|||..:.::||||:.||:|:..|.|:|..:|.|||||||||||||.||.||||.
Mouse   117 RPPYSYSALIAMAIHGAPDQRLTLSQIYQYVADNFPFYNKSKAGWQNSIRHNLSLNDCFKKVPRD 181

  Fly   245 YDDPGKGNYWMLDPSAEDVFIGGSTGKLRRR--TTAASRSRLAAFK--RSLIGPMFPGLAAYPQF 305
            .|||||||||.|||:.|.:|..|:..:.|:|  .:::|.|.||:.|  ..|       ||:.|: 
Mouse   182 EDDPGKGNYWTLDPNCEKMFDNGNFRRKRKRKSDSSSSTSSLASEKTENGL-------LASSPK- 238

  Fly   306 GQFLTYPPTAP----------SLLASMYQRYNPFAPKGGP 335
                   ||.|          :..:|..:|.:| ||.|.|
Mouse   239 -------PTEPQEVLDTASPDTTTSSPEKRSSP-APSGTP 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp2NP_476834.1 Forkhead 180..265 CDD:306709 54/84 (64%)
Foxi1NP_076396.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23
FH 117..205 CDD:214627 55/87 (63%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 202..271 22/85 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.