DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp2 and LOC101730723

DIOPT Version :9

Sequence 1:NP_476834.1 Gene:slp2 / 33608 FlyBaseID:FBgn0004567 Length:451 Species:Drosophila melanogaster
Sequence 2:XP_031760018.1 Gene:LOC101730723 / 101730723 -ID:- Length:337 Species:Xenopus tropicalis


Alignment Length:377 Identity:107/377 - (28%)
Similarity:142/377 - (37%) Gaps:117/377 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 DVTSMSPAPVANPNESDPDEVDEEFVEEDIECDGETTDGDAE-NKSNDGKPVKDKKGNE---KPP 182
            |...:.|.|.:...:|.|...:...:....:.|.|   |..| :.|.|.|..|.||..:   |||
 Frog     9 DPAFLPPQPPSMEKKSAPAAANRATLPPSPKGDSE---GPREPDSSADWKKKKKKKSYQRYAKPP 70

  Fly   183 YSYNALIMMAIRQSSEKRLTLNGIYEYIMTNHPYYRDNKQGWQNSIRHNLSLNKCFVKVPRHYDD 247
            |||.|:|.:.|:...||||.|:.|.:.|.:..|:::.|.|||::|||||||.|.||.||.:   |
 Frog    71 YSYLAMIALVIQNCPEKRLKLSQILQDISSLFPFFKGNYQGWKDSIRHNLSSNDCFRKVLK---D 132

  Fly   248 P----GKGNYWMLD-----PSA----------EDVF--------IGG-------STGKLRRRTTA 278
            |    .|||||.:|     |.|          :|:|        :.|       |....|..||.
 Frog   133 PLKPQAKGNYWTVDVTRIPPDALKLQNTAVTRQDLFPLDLAPYILHGQPYRERHSANHTREHTTP 197

  Fly   279 ASRSRLAAFKRSLIGPMFPGLAAYPQFGQFLTYPPT------APSLLA----------------S 321
            ....::|        |..|.......|...|...||      ||:::|                |
 Frog   198 RMELKVA--------PQIPVSDPAVSFPMILWNLPTSYTKCVAPNVVAPPSVHPLLLYSNFPSIS 254

  Fly   322 MYQRYNPFAPKGGPGH--PGLPPGLPGLPGPPGPQGPPGPPPP---PFVAPPTSSELYQRLQYQQ 381
            :|....|  |.|.|.:  ..|.|.:|..|.||..:.||...||   .|..|..||          
 Frog   255 IYNYLPP--PYGSPVYSASSLHPQIPLTPRPPELKNPPSDFPPNKTVFDIPVYSS---------- 307

  Fly   382 LLHQHAAAAALAAHQRQLSVAAASAASQPPPTHHHPHLAVGQAPL---SPGG 430
                           |...||:        |....||||...:||   .|.|
 Frog   308 ---------------RPGLVAS--------PGLFSPHLAAATSPLLGYRPSG 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp2NP_476834.1 Forkhead 180..265 CDD:306709 45/111 (41%)
LOC101730723XP_031760018.1 COG5025 66..>322 CDD:227358 85/301 (28%)
FH_FOXH 68..146 CDD:410796 40/80 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.