DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp2 and foxd2

DIOPT Version :9

Sequence 1:NP_476834.1 Gene:slp2 / 33608 FlyBaseID:FBgn0004567 Length:451 Species:Drosophila melanogaster
Sequence 2:XP_002931458.1 Gene:foxd2 / 100495241 XenbaseID:XB-GENE-479818 Length:348 Species:Xenopus tropicalis


Alignment Length:415 Identity:121/415 - (29%)
Similarity:159/415 - (38%) Gaps:111/415 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 LKSSFSINSILPETVEHHDEDEEEDVEKKSPAKFPPNHNNNNLNTTNWGSPEDHEAESDPESDLD 122
            |.:..|.||:|.|..   |.|...|:..|. .|:...|::|:   ::...|..|  ..||.|   
 Frog     3 LGTEMSDNSLLSEDT---DIDVVGDMGAKD-GKYSDYHSDND---SDDNGPRTH--RGDPAS--- 55

  Fly   123 VTSMSPAPVANPNESDPDEVDEEFVEEDIECDGETTDGDAENKSNDGKPVKDKKGNEKPPYSYNA 187
                            ||                .:.|...|:..:..|   |....||||||.|
 Frog    56 ----------------PD----------------LSSGSESNQRAEKPP---KNALVKPPYSYIA 85

  Fly   188 LIMMAIRQSSEKRLTLNGIYEYIMTNHPYYRDNKQGWQNSIRHNLSLNKCFVKVPRHYDDPGKGN 252
            ||.|||.||.:|||||:.|.|:|....||||:....||||||||||||.||||:||...:|||||
 Frog    86 LITMAILQSPKKRLTLSEICEFISNRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGN 150

  Fly   253 YWMLDPSAEDVFIGGSTGKLRRRTTAASRSRLAAFKRS-----LIGP--MFPGLAAYPQFGQFLT 310
            ||.|||.:.|:|..||..:.|:|           |||.     |..|  ..|....|..:|  ..
 Frog   151 YWTLDPESADMFDNGSFLRRRKR-----------FKRQQSNEILRDPSSFMPAAFGYGPYG--YN 202

  Fly   311 YPPTAPSLLASMYQRYNPFAPKGG-----PGHPGLPPGLPGLPGPPGPQGPPGPPPPPFVAPPTS 370
            |        ....|.|:.....|.     |.|..|||             |......|.::|...
 Frog   203 Y--------GLQLQNYHQHHHTGATFSFQPTHCPLPP-------------PASVFSSPTLSPFLG 246

  Fly   371 SELYQRLQYQQL-----LHQHAAAAALAAHQRQLSVAAASAASQPPPTHHHPHLAVGQAPLSPGG 430
            :||.::..|.||     :.|.......:.....:......:.|.|.||..:        .:.||.
 Frog   247 NELTRKSFYSQLSPTLPILQTLKPDGQSRPSFSIDNIIGGSGSTPSPTSPY--------TVQPGN 303

  Fly   431 DSP-----GPSPQPLHKPVTVVSRN 450
            ..|     .||..|:...:.:...|
 Frog   304 QPPVIAMLSPSLAPMQNHLNLSHEN 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp2NP_476834.1 Forkhead 180..265 CDD:306709 55/84 (65%)
foxd2XP_002931458.1 Forkhead 78..163 CDD:365978 55/84 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.