DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp2 and foxl3-ot1

DIOPT Version :9

Sequence 1:NP_476834.1 Gene:slp2 / 33608 FlyBaseID:FBgn0004567 Length:451 Species:Drosophila melanogaster
Sequence 2:XP_002932017.1 Gene:foxl3-ot1 / 100488925 XenbaseID:XB-GENE-6035521 Length:246 Species:Xenopus tropicalis


Alignment Length:162 Identity:70/162 - (43%)
Similarity:92/162 - (56%) Gaps:23/162 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 NKSNDGKPV----KDKKGNEKPPYSYNALIMMAIRQSSEKRLTLNGIYEYIMTNHPYYRDNKQGW 224
            |...|..|.    ::||.| :|.|||.|||.|||:||.:.::||:|||::||...||||.|::.|
 Frog    13 NYDGDDYPACSSDEEKKFN-RPAYSYIALIAMAIQQSPDSKVTLSGIYDFIMKKFPYYRSNQRAW 76

  Fly   225 QNSIRHNLSLNKCFVKVPR-HYDDPGKGNYWMLDPSAE---DVFIGGSTGKLRRRTT--AASRSR 283
            |||||||||||.||||||| ..::.||||||......|   |:|..|:..:.|||..  ...:.|
 Frog    77 QNSIRHNLSLNSCFVKVPRTEGNEKGKGNYWSFASGCESMLDLFENGNYKRRRRRRNMKKCQKDR 141

  Fly   284 LAAFKRSLIGPMFPGLAAYPQFGQFLTYPPTA 315
                |::....:.|        |:|.|...||
 Frog   142 ----KQNQAQALHP--------GEFSTSSSTA 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp2NP_476834.1 Forkhead 180..265 CDD:306709 51/88 (58%)
foxl3-ot1XP_002932017.1 Forkhead 32..118 CDD:365978 50/85 (59%)
COG5025 33..>224 CDD:227358 64/141 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.