DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp2 and foxl2

DIOPT Version :9

Sequence 1:NP_476834.1 Gene:slp2 / 33608 FlyBaseID:FBgn0004567 Length:451 Species:Drosophila melanogaster
Sequence 2:XP_004917868.1 Gene:foxl2 / 100486124 XenbaseID:XB-GENE-486612 Length:326 Species:Xenopus tropicalis


Alignment Length:303 Identity:103/303 - (33%)
Similarity:132/303 - (43%) Gaps:85/303 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 DAENKSNDGKPVKDKK---GNEKPPYSYNALIMMAIRQSSEKRLTLNGIYEYIMTNHPYYRDNKQ 222
            :||....|..|.|.::   .::||||||.|||.||||:|:||||||:.||:||::..|:|..||:
 Frog    48 EAERSKEDLLPEKGQEKPDPSQKPPYSYVALIAMAIRESAEKRLTLSAIYQYIISKFPFYEKNKK 112

  Fly   223 GWQNSIRHNLSLNKCFVKVPRHYDDPGKGNYWMLDPSAEDVFIGGSTGKLRRRTTAASRSRLAAF 287
            |||||||||||||:||:||||......|||||.|||:.||:|   ..|..|||            
 Frog   113 GWQNSIRHNLSLNECFIKVPREGGGERKGNYWTLDPACEDMF---EKGNYRRR------------ 162

  Fly   288 KRSLIGPMFPGLAAYPQFGQFLTYPPT----APSLLASMYQRYNPFAPKGGPGHPGLPPGLPG-- 346
             |.:..|..|              |||    ..||.:|  ..|...:|         |..|..  
 Frog   163 -RRMKRPFRP--------------PPTHFQAGKSLFSS--DTYGYLSP---------PKYLQSTF 201

  Fly   347 ------LPGPPGPQ---------GPPGPPPPPFVAPPTSSELYQRLQYQQLLHQHAAAAALAAHQ 396
                  |..||.|.         |...|.....::..:|...|.|:|                  
 Frog   202 MNNSWPLAQPPAPMSYTSCQMAGGNVSPVNVKGLSASSSYSPYSRVQ------------------ 248

  Fly   397 RQLSVAAASAASQPPPTHHHPHLAVGQAPLSPGGDSPGPSPQP 439
             .:|:.:...:......|||||....| .|||...:|.|...|
 Frog   249 -SMSLPSMVNSYNGMSHHHHPHAHHAQ-QLSPASPAPAPPAPP 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp2NP_476834.1 Forkhead 180..265 CDD:306709 57/84 (68%)
foxl2XP_004917868.1 Forkhead 69..155 CDD:365978 58/88 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.