DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp2 and foxd4l1.2

DIOPT Version :9

Sequence 1:NP_476834.1 Gene:slp2 / 33608 FlyBaseID:FBgn0004567 Length:451 Species:Drosophila melanogaster
Sequence 2:XP_002935635.1 Gene:foxd4l1.2 / 100485983 XenbaseID:XB-GENE-876578 Length:338 Species:Xenopus tropicalis


Alignment Length:269 Identity:87/269 - (32%)
Similarity:120/269 - (44%) Gaps:66/269 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 EDHEAESDPESDLDVTS-------------------------MSPAPVANPNESDPDEVDEEFVE 148
            :|:...||.|.::|:..                         :||:.::....|           
 Frog    14 QDYTGVSDEEDEIDILGENDSCNLRLHINQQPTHSEIGDSGVLSPSKLSGTENS----------- 67

  Fly   149 EDIEC-DGETTDGDAENKSNDGKPVKDKKGNE---KPPYSYNALIMMAIRQSSEKRLTLNGIYEY 209
                | ..|..:|.....|....|  |.|.:.   ||||||.|||.|||.||..::|||:||.::
 Frog    68 ----CHSSEEKEGGTSKDSLHTTP--DSKASRAFLKPPYSYIALITMAIVQSPYRKLTLSGICDF 126

  Fly   210 IMTNHPYYRDNKQGWQNSIRHNLSLNKCFVKVPRHYDDPGKGNYWMLDPSAEDVFIGGSTGKLRR 274
            |.:..|||:|....||||||||||||.||:|:||...:|||||||.|||:::|:|..||..:.|:
 Frog   127 ISSKFPYYKDKFPAWQNSIRHNLSLNDCFIKIPREPGNPGKGNYWTLDPASKDMFDNGSFLRRRK 191

  Fly   275 RTTAASRSRLAAFKRSLIGPMFPGLAAYPQFGQFLTYPPTAPSLLASMYQRYNPFAPKGGPGHPG 339
            |           |||.....:..|...|... .::| |.:||       |...|......|.:..
 Frog   192 R-----------FKRHHQELIKDGFLMYNPL-HYIT-PYSAP-------QTQTPVICMAIPQNLA 236

  Fly   340 LPPGLPGLP 348
            :|..|...|
 Frog   237 MPNHLAPYP 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp2NP_476834.1 Forkhead 180..265 CDD:306709 52/84 (62%)
foxd4l1.2XP_002935635.1 Forkhead 97..182 CDD:365978 52/84 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.