DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp2 and foxl2b

DIOPT Version :9

Sequence 1:NP_476834.1 Gene:slp2 / 33608 FlyBaseID:FBgn0004567 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_001304690.1 Gene:foxl2b / 100149117 ZFINID:ZDB-GENE-170803-1 Length:285 Species:Danio rerio


Alignment Length:277 Identity:102/277 - (36%)
Similarity:138/277 - (49%) Gaps:50/277 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 DGDAENKSNDGKPVKDKKGNE------KPPYSYNALIMMAIRQSSEKRLTLNGIYEYIMTNHPYY 217
            |.:|..|.::  |::: .|:|      ||||||.|||.||||:|:||||||:|||:||:|..|:|
Zfish    18 DTNAVKKEDE--PLQE-PGSEKTDPAQKPPYSYVALIAMAIRESTEKRLTLSGIYQYIITKFPFY 79

  Fly   218 RDNKQGWQNSIRHNLSLNKCFVKVPRHYDDPGKGNYWMLDPSAEDVFIGGSTGKLRRRTTAASRS 282
            ..||:|||||||||||||:||:||||......|||||.|||:.||:|..|:. :.|||.....|.
Zfish    80 EKNKKGWQNSIRHNLSLNECFIKVPREGGGERKGNYWTLDPACEDMFEKGNY-RRRRRMKRPFRP 143

  Fly   283 RLAAFK--RSLI-GPMFPGLAAYPQFGQ--FLTY-------PPTAPS-------------LLASM 322
            ..|.|:  :||. |..:.|....|::.|  |:..       ||.|.|             :.|..
Zfish   144 PAAHFQAGKSLFGGDAYTGYLPAPKYLQSGFMNSSWPLPQPPPPAMSYASCQMPNGNMGAMKALS 208

  Fly   323 YQRYNPFAPKGGPGHPGLPPGLPGLPGPPGPQGPPGPPPP-------PFVAPPTSSELYQRLQYQ 380
            ...|||::.....|.|.:.....|:.....||.......|       .|......:|||...:::
Zfish   209 TPSYNPYSRMQAMGLPNMMNSYGGMGHHQQPQHQQQSAAPSNSAAALQFTCSRQPAELYSYWEHE 273

  Fly   381 QLLHQHAAAAALAAHQR 397
                    |.:.|.|.|
Zfish   274 --------AKSSALHSR 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp2NP_476834.1 Forkhead 180..265 CDD:306709 59/84 (70%)
foxl2bNP_001304690.1 FH 42..130 CDD:214627 60/87 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.