DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp2 and foxg1

DIOPT Version :9

Sequence 1:NP_476834.1 Gene:slp2 / 33608 FlyBaseID:FBgn0004567 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_001116933.1 Gene:foxg1 / 100144706 XenbaseID:XB-GENE-480076 Length:432 Species:Xenopus tropicalis


Alignment Length:442 Identity:169/442 - (38%)
Similarity:211/442 - (47%) Gaps:126/442 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 KSSFSINSILPETVEHHDEDEEEDVEKKSPAKFPPNHNNNNLNTTNWG---SPEDHEAESDPESD 120
            ||||||||::||.|::.:..:            |.:|::::|......   .|.....:.:.|.|
 Frog    12 KSSFSINSLVPEAVQNDNHPQ------------PHHHHHHHLQLPQQSHHLQPHHRPLQEEDELD 64

  Fly   121 ---LDVTSMSPAPVANPNESDPDEVDEEFVEEDIE-CDGETTDGDAENKSNDGKPVKDKKGN--E 179
               |:|.:.|    ..|.:.||  ...|...||.| .:.:..||.......:||...:||..  |
 Frog    65 KSLLEVKTES----LPPGKGDP--AASELPGEDKEKSEDKKADGGGGKDGENGKEGGEKKNGKYE 123

  Fly   180 KPPYSYNALIMMAIRQSSEKRLTLNGIYEYIMTNHPYYRDNKQGWQNSIRHNLSLNKCFVKVPRH 244
            |||:|||||||||||||.|||||||||||:||.|.||||:|||||||||||||||||||||||||
 Frog   124 KPPFSYNALIMMAIRQSPEKRLTLNGIYEFIMKNFPYYRENKQGWQNSIRHNLSLNKCFVKVPRH 188

  Fly   245 YDDPGKGNYWMLDPSAEDVFIGGSTGKLRRRTTAASRSRLAAFKR----------------SLIG 293
            |||||||||||||||::||||||:|||||||:| .||::| ||||                ||..
 Frog   189 YDDPGKGNYWMLDPSSDDVFIGGTTGKLRRRST-TSRAKL-AFKRGARLTSTGLTFMDRAGSLYW 251

  Fly   294 PMFPGLAA-YPQFGQFLTYPPTAPSLLASMYQRYNPFAPKGGPGHPGLPPGLPGLPGPPGPQGPP 357
            ||.|.|:. :|:....|:|..|     .|.|           |.||                   
 Frog   252 PMSPFLSLHHPRASSALSYNGT-----TSAY-----------PSHP------------------- 281

  Fly   358 GPPPPPFVAPPTSSELYQR-------------LQYQQLLH-------QHAAAAALAAH-QRQLSV 401
                     .|.||.|.|.             |...:|::       .|..||||||. ...|.|
 Frog   282 ---------MPYSSVLTQNSLGSNHSFSTSNGLSVDRLVNGEIPYATHHLTAAALAASVPCGLPV 337

  Fly   402 AAASAASQPPPT------------HHHPHLAV---GQAPLSPGGDSPGPSPQ 438
            ..:...|..|.:            .|.||.::   ....::....|...|||
 Frog   338 PCSGTYSLNPCSVNLLAGQTGYFFPHVPHPSITSQSSTSMAARAASSSTSPQ 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp2NP_476834.1 Forkhead 180..265 CDD:306709 76/84 (90%)
foxg1NP_001116933.1 FH 124..212 CDD:214627 79/87 (91%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 172 1.000 Domainoid score I3689
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 227 1.000 Inparanoid score I3402
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 1 1.000 - - otm49365
Panther 1 1.100 - - LDO PTHR46617
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1751
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.070

Return to query results.
Submit another query.