DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp2 and foxg1d

DIOPT Version :9

Sequence 1:NP_476834.1 Gene:slp2 / 33608 FlyBaseID:FBgn0004567 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_001116096.1 Gene:foxg1d / 100142648 ZFINID:ZDB-GENE-080305-12 Length:316 Species:Danio rerio


Alignment Length:403 Identity:152/403 - (37%)
Similarity:184/403 - (45%) Gaps:148/403 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 MKMARTPHLK--SSFSINSILPETVEHHDEDEEEDVEKKSPAKFPPNHNNNNLNTTNWGSPEDHE 112
            |:...:|.|:  |||||.|:|                  .|.|.              |:|.|..
Zfish     1 MEQKESPALQKLSSFSITSLL------------------LPGKS--------------GTPADSS 33

  Fly   113 AESDPESDLDVTSMSPAPVANPNESDPDEVDEEFVEEDIECDGETTDGDAENKSNDGKPVKDKKG 177
            ..:||.|:                                   |.:...|::..:.|||||    
Zfish    34 PVTDPPSE-----------------------------------ERSSEKAKDAEDAGKPVK---- 59

  Fly   178 NEKPPYSYNALIMMAIRQSSEKRLTLNGIYEYIMTNHPYYRDNKQGWQNSIRHNLSLNKCFVKVP 242
            .:|||:|||||||||||||.|||||||||||:||.|.|:||::||||||||||||||||||||||
Zfish    60 LDKPPFSYNALIMMAIRQSPEKRLTLNGIYEFIMKNFPFYREHKQGWQNSIRHNLSLNKCFVKVP 124

  Fly   243 RHYDDPGKGNYWMLDPSAEDVFIGGSTGKLRRRTTAASRSRLAAFKRSL-IGPMFPGLAAYPQFG 306
            |||||||||||||||||::||||||:||||||| :|.||.:| |.||.| ..|:  ||....:..
Zfish   125 RHYDDPGKGNYWMLDPSSDDVFIGGTTGKLRRR-SATSRGKL-AIKRGLRFSPL--GLHGITETA 185

  Fly   307 QFLTYPPTAPSLLASMYQRYNPF-----------------------------APK----GGPGHP 338
            ....|...:| ||:..:..::|.                             ||:    |..|..
Zfish   186 NNPLYWQLSP-LLSLHHHHHHPHYNGTSHGFLNQAHGYGSFVHGVEHLGSREAPRAVLGGSSGAL 249

  Fly   339 GL---------PPGLPGLPG----PPGPQGPPGPPPP------PFVAPPTSSELYQRLQYQQLLH 384
            ||         |.||..:|.    .||.|...|.|..      ||.  ||.:             
Zfish   250 GLSNGYGMSSSPVGLLSVPSGLLPAPGLQSALGAPQSLRTALGPFT--PTGA------------- 299

  Fly   385 QHAAAAALAAHQR 397
              ||..|||.|.|
Zfish   300 --AALPALAHHDR 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp2NP_476834.1 Forkhead 180..265 CDD:306709 74/84 (88%)
foxg1dNP_001116096.1 FH 62..150 CDD:214627 77/87 (89%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596115
Domainoid 1 1.000 172 1.000 Domainoid score I3672
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 1 1.000 - - otm25551
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46617
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1751
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1110.810

Return to query results.
Submit another query.