DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp2 and foxj3

DIOPT Version :9

Sequence 1:NP_476834.1 Gene:slp2 / 33608 FlyBaseID:FBgn0004567 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_001103516.1 Gene:foxj3 / 100126207 XenbaseID:XB-GENE-481185 Length:603 Species:Xenopus tropicalis


Alignment Length:119 Identity:56/119 - (47%)
Similarity:81/119 - (68%) Gaps:4/119 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 NKSNDGKPVKDKKGNEKPPYSYNALIMMAIRQSSEKRLTLNGIYEYIMTNHPYYRDNKQGWQNSI 228
            |.:.|.:.|:..| :.||||||.:||..||..|.:|::||:.||::|..|.|||::...||:|||
 Frog    48 NTTLDQEEVQQHK-DGKPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYKEAGSGWKNSI 111

  Fly   229 RHNLSLNKCFVKVPRHYDDPGKGNYWMLDPSAEDVFIGGSTGKLRRRTTAASRS 282
            ||||||||||:||||..||||||:||.:|.:.::   ..:..:.|:|..:..|:
 Frog   112 RHNLSLNKCFLKVPRSKDDPGKGSYWAIDTNPKE---DAAQARPRKRPRSEERA 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp2NP_476834.1 Forkhead 180..265 CDD:306709 49/84 (58%)
foxj3NP_001103516.1 FH_FOXJ3 62..140 CDD:410826 48/77 (62%)
COG5025 <63..329 CDD:227358 52/103 (50%)
KLF1_2_4_N <342..419 CDD:425360
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.