Sequence 1: | NP_476834.1 | Gene: | slp2 / 33608 | FlyBaseID: | FBgn0004567 | Length: | 451 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001107970.1 | Gene: | foxb1 / 100125219 | XenbaseID: | XB-GENE-1018255 | Length: | 322 | Species: | Xenopus tropicalis |
Alignment Length: | 313 | Identity: | 92/313 - (29%) |
---|---|---|---|
Similarity: | 118/313 - (37%) | Gaps: | 112/313 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 170 KPVKDKKGNEKPPYSYNALIMMAIRQSSEKRLTLNGIYEYIMTNHPYYRDNKQGWQNSIRHNLSL 234
Fly 235 NKCFVKVPRHYDDPGKGNYWMLDPSAEDVFIGGS------------------------------T 269
Fly 270 GKLRRRTTAASRSRL-------------AAFKRSL-----------------IGPMFPGLAAYPQ 304
Fly 305 FGQFLTYPPTAPSLLASMYQR---------------YN------PFAP--KGGPGHPGLP----- 341
Fly 342 -----PGLPGLP--------------GPPGP-----QGPPGPPPPPFVAPPTS 370 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
slp2 | NP_476834.1 | Forkhead | 180..265 | CDD:306709 | 50/84 (60%) |
foxb1 | NP_001107970.1 | FH | 13..101 | CDD:214627 | 51/87 (59%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000010 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R2114 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.940 |