DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp2 and foxf2

DIOPT Version :9

Sequence 1:NP_476834.1 Gene:slp2 / 33608 FlyBaseID:FBgn0004567 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_001093702.1 Gene:foxf2 / 100101712 XenbaseID:XB-GENE-484646 Length:381 Species:Xenopus tropicalis


Alignment Length:347 Identity:103/347 - (29%)
Similarity:150/347 - (43%) Gaps:59/347 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 PESDLDVTSMSPAPVANPNESDPDEVDEEFVEEDIECDGETTDGDAENKSNDGKPVKDKKGNEKP 181
            |...||       |.|.|..::|.....:......:.....|...:.:.|.:.||....:..|||
 Frog     6 PSQHLD-------PSAAPIRTNPATGTLQSALMSQQSTAMDTTSSSSSSSKNKKPNSGLRRPEKP 63

  Fly   182 PYSYNALIMMAIRQSSEKRLTLNGIYEYIMTNHPYYRDNKQGWQNSIRHNLSLNKCFVKVPRHYD 246
            ||||.|||:|||:.|..|||||:.||:::....|::|.:.|||:||:|||||||:||:|:|:...
 Frog    64 PYSYIALIVMAIQSSPTKRLTLSEIYQFLQARFPFFRGSYQGWKNSVRHNLSLNECFIKLPKGLG 128

  Fly   247 DPGKGNYWMLDPSAEDVFIGGSTGKLRRRTTAASRSRLAAFKRSLIGPMFP-------GLAAYPQ 304
            .||||:||.:||::|.:|   ..|..|||.....|      |...:.||:.       ..:..||
 Frog   129 RPGKGHYWTIDPASEFMF---EEGSFRRRPRGFRR------KCQALKPMYRMMNGIGFSTSILPQ 184

  Fly   305 FGQFLTYPPTAPSLLASMYQRYNPFAPKGGPGHPGLPPG--LPGLPGPPG-------PQGPPGPP 360
            ...|.. ||.:.:..::.| ..:..:.....|:.||..|  :|.:...||       |....|..
 Frog   185 GFDFQA-PPASLTCHSNGY-NLDMMSNSMAGGYDGLAGGHHVPHMSPNPGSTYMASCPVSSSGDY 247

  Fly   361 PPPFVAPPTSSELYQRLQYQQLLHQHAAAAALAAHQRQLSVAAASAASQPPPTHHHPHLAVGQAP 425
            .|...:.|..|             ..|.|:|:..|....|..|..|:|...|       .:.|.|
 Frog   248 GPDSSSSPVPS-------------SPAMASAMECHSPYTSPTAHWASSGASP-------YLKQQP 292

  Fly   426 LSP-----GGDSPGPSPQPLHK 442
            :.|     .|...|.||..|.:
 Frog   293 MPPSNGASAGIHTGVSPYSLEQ 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp2NP_476834.1 Forkhead 180..265 CDD:306709 47/84 (56%)
foxf2NP_001093702.1 Forkhead 61..147 CDD:365978 49/88 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.