DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp2 and foxl2l

DIOPT Version :9

Sequence 1:NP_476834.1 Gene:slp2 / 33608 FlyBaseID:FBgn0004567 Length:451 Species:Drosophila melanogaster
Sequence 2:NP_001122282.1 Gene:foxl2l / 100004081 ZFINID:ZDB-GENE-081022-71 Length:260 Species:Danio rerio


Alignment Length:316 Identity:101/316 - (31%)
Similarity:126/316 - (39%) Gaps:97/316 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 DIECDGETTDGDAENKSNDGKPVKDKKGNEKPPYSYNALIMMAIRQSSEKRLTLNGIYEYIMTNH 214
            |::|.....:..:|.....|.    ....|||||||.|||.||||:|.:|:||||.||.||::..
Zfish     9 DLQCRDAAVEDCSETAGCPGA----APAPEKPPYSYVALIAMAIRESEDKKLTLNDIYSYIISKF 69

  Fly   215 PYYRDNKQGWQNSIRHNLSLNKCFVKVPRHYDDPGKGNYWMLDPSAEDVFIGGSTGKLRRRTTAA 279
            |||..||:|||||||||||||:||||:||......|||:|.|||:..|:|   ..|..|||... 
Zfish    70 PYYEKNKKGWQNSIRHNLSLNECFVKIPRESGGERKGNFWTLDPAFNDMF---EKGNYRRRRRV- 130

  Fly   280 SRSRLAAFKRSLIGPMFPGLAAYPQFGQFLTYPPTAPSLLASMYQRYNPFAPKGGP--------- 335
                    ||                       |..|:.|.|.|...:|:..:..|         
Zfish   131 --------KR-----------------------PYRPAALPSGYNFADPYCLQQEPVYWQSPFVS 164

  Fly   336 -----GHPGLPPGLPG-LPGPPGPQGPPGPPPPPFVAPPTSSELYQRLQYQQLLHQHAAAAALAA 394
                 .|.|.|..:.. :.|...|..     |..|...|.|        |....|.|        
Zfish   165 SGSWSHHSGSPTHISSYMLGNARPLS-----PNDFANSPVS--------YYHGHHPH-------- 208

  Fly   395 HQRQLSVAAASAASQPP--PTHHHPHLAVGQA----PLSPGGDSPGP---SPQPLH 441
                         ..|.  |.|.||:..|..:    |:||||.|...   :||..|
Zfish   209 -------------FHPSYRPYHRHPNALVPLSGMTPPVSPGGSSISTCSYAPQNSH 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp2NP_476834.1 Forkhead 180..265 CDD:306709 55/84 (65%)
foxl2lNP_001122282.1 Forkhead 35..121 CDD:278670 56/88 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.