DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and FOXH1

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_003914.1 Gene:FOXH1 / 8928 HGNCID:3814 Length:365 Species:Homo sapiens


Alignment Length:152 Identity:54/152 - (35%)
Similarity:85/152 - (55%) Gaps:10/152 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 DQESEDGNPSKKQKMTAGSDTKKPPYSYNALIMMAIQDSPEQRLTLNGIYQYLINRFPYFKANKR 162
            :.||....|.:::|.....|  ||||:|.|:|.:.||.:|.:||.|..|.:.:...||:|:.:..
Human    13 EAESPSQPPKRRKKRYLRHD--KPPYTYLAMIALVIQAAPSRRLKLAQIIRQVQAVFPFFREDYE 75

  Fly   163 GWQNSIRHNLSLNKCFTKIPRSYDDP-GKGNYWILDPS---AEEVFIGETTGKLRRKNPGASRTR 223
            ||::|||||||.|:||.|:|:....| .|||:|.:|.|   ||.:.: :.|...||...|.:|  
Human    76 GWKDSIRHNLSSNRCFRKVPKDPAKPQAKGNFWAVDVSLIPAEALRL-QNTALCRRWQNGGAR-- 137

  Fly   224 LAAYRQAIFSPMMAASPYGAPA 245
             .|:.:.:...::...||..|:
Human   138 -GAFAKDLGPYVLHGRPYRPPS 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 40/88 (45%)
FOXH1NP_003914.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..29 4/15 (27%)
FH 33..111 CDD:238016 36/77 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 151..215 3/8 (38%)
SMAD-interaction domain (SID) 273..354
Fast/FoxH1 motif 1 (FM1) 277..281
Fast/FoxH1 motif 2 (FM2) 287..293
SMAD interaction motif (SIM) 327..348
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.