DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and FHL1

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_015429.1 Gene:FHL1 / 856219 SGDID:S000006308 Length:936 Species:Saccharomyces cerevisiae


Alignment Length:243 Identity:64/243 - (26%)
Similarity:91/243 - (37%) Gaps:87/243 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 QNNDKLDVEFDDELEDQLDEDQESEDGNPSKKQKMTAGSDTK----------------------- 119
            :|:|....|..|..|.::: .:..:...|..|:|:|.|:..|                       
Yeast   387 RNDDSKSPENADIAESEIN-TRNLKKNEPKSKKKITTGAKPKKAQTKPAVKKEKKPPKIPKKVYT 450

  Fly   120 ----------KPPYSYNALIMMAIQD-SPEQRLTLNGIYQYLINRFPYFKANKRGWQNSIRHNLS 173
                      ||..||:|::...|:. |..:.::|:.||..:...|||:|....|||:|:|||||
Yeast   451 LEEIPVEYRTKPTVSYSAMLTTCIRKYSTAKGMSLSEIYAGIRELFPYYKYCPDGWQSSVRHNLS 515

  Fly   174 LNKCFTKIPRSYDDPGKGNYWILDPSAEEVFIGETTGKLRRKNPGASRTRLAAYRQAIFSPMMAA 238
            |||.|.|:.:.    |||..|.||    |.:|.|             |.|....:..|       
Yeast   516 LNKSFRKVSKE----GKGWLWGLD----EEYIAE-------------RERQKKKQSEI------- 552

  Fly   239 SPYGAPASSYGYPAVPFAAAAAAALYQRMNPAAYQAAYQQMQYQQAPQ 286
                         ||..|.||...|.|           ||.:.||.||
Yeast   553 -------------AVAKAQAAQLKLEQ-----------QQHKLQQVPQ 576

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 35/85 (41%)
FHL1NP_015429.1 COG5025 18..739 CDD:227358 64/243 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.