DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and FKH2

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_014331.3 Gene:FKH2 / 855656 SGDID:S000005012 Length:862 Species:Saccharomyces cerevisiae


Alignment Length:281 Identity:79/281 - (28%)
Similarity:124/281 - (44%) Gaps:37/281 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 NSDGEL-SASEDFDSPSRTSTPMSSAAESLSSQNNDKLDVEFDDELEDQLDEDQESEDGNPSKKQ 110
            |.:|.. |.:.::.:.:.||..::..|.|.....|..:...|.|        ..:|.:..|   |
Yeast   270 NKNGYFTSINPNYTASTTTSNTINPQAASPQGPPNTIIAANFVD--------SYKSSNAYP---Q 323

  Fly   111 KMTAGSDTK-------KPPYSYNALIMMAIQDSPEQRLTLNGIYQYLINRFPYFKANKRGWQNSI 168
            .:...||..       |||:||..:|..||..|||..::|..||:|:.:.:.|::..|.||||||
Yeast   324 ALDFTSDLSHDENRNVKPPHSYATMITQAILSSPEGVISLADIYKYISSNYAYYRFAKSGWQNSI 388

  Fly   169 RHNLSLNKCFTKIPRSYDDPGKGNYWILDPSAEEVFIGE-TTGKLRRKNPGASRTRLAAYRQAIF 232
            ||||||||.|.|:||..::||||..|.:..|.::.|:.: .|||:.:...|:|..|......|.|
Yeast   389 RHNLSLNKAFEKVPRRPNEPGKGMKWRISESYQQEFLNKWNTGKVGKIRRGSSVARQLQLHMAKF 453

  Fly   233 SPMMAASPYGAPASSYGYPAVPFAAAAAAALYQRMNPAAYQAAYQQM---------QYQQAPQAH 288
            :.:.....|   ..|......|.....:..:.:..|....:...|.:         |..|.|.:|
Yeast   454 NSLPMEMDY---RLSLNMAQPPKRQLQSHNVLEPSNNNIIEGFVQHVPSKGNLPASQQSQPPVSH 515

  Fly   289 HHQAPHPAQMQGYPQQLNAEL 309
            .:|:..|.     ||:...|:
Yeast   516 QNQSQQPP-----PQEQRQEI 531

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 41/84 (49%)
FKH2NP_014331.3 COG5025 1..610 CDD:227358 79/281 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 97 1.000 Domainoid score I1615
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 1 1.000 - - otm46522
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.