DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and HCM1

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_009991.2 Gene:HCM1 / 850429 SGDID:S000000661 Length:564 Species:Saccharomyces cerevisiae


Alignment Length:174 Identity:62/174 - (35%)
Similarity:84/174 - (48%) Gaps:19/174 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 ASEDFDSPSRTSTPMSSAAESLSSQNNDK----LDVEFDDELEDQLDEDQESE-----DGN---- 105
            |....:......||.||.......:.|.:    |..:....:.....:.|.|:     :||    
Yeast    27 AKRTLEDEKEMITPPSSTVRKTMKEVNKRPSHPLSPDHSSPIAPSKAKRQRSDTCARSNGNLTLE 91

  Fly   106 ---PSKKQKMTAGSDTKKPPYSYNALIMMAIQDSPEQRLTLNGIYQYLINRFPYFKANKRGWQNS 167
               .|.:::...|...|||||||..||.:||..|.|.:|||:.||.::...|||:|.....||||
Yeast    92 EILQSLERRRINGELAKKPPYSYATLICLAILQSQEGKLTLSQIYHWIHVHFPYYKQKDASWQNS 156

  Fly   168 IRHNLSLNKCFTKIPRSYDDPGKGNYWILDPSAE-EVFIGETTG 210
            ||||||||..|.|..:|.|  |||::|.:.|.|| :.|.||..|
Yeast   157 IRHNLSLNDAFIKTEKSCD--GKGHFWEVRPGAETKFFKGENRG 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 44/85 (52%)
HCM1NP_009991.2 COG5025 20..564 CDD:227358 62/174 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 1 1.000 - - otm46522
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.940

Return to query results.
Submit another query.