DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and foxb1b

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_571358.2 Gene:foxb1b / 799571 ZFINID:ZDB-GENE-990415-77 Length:296 Species:Danio rerio


Alignment Length:259 Identity:75/259 - (28%)
Similarity:109/259 - (42%) Gaps:74/259 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 KKPPYSYNALIMMAIQDSPEQRLTLNGIYQYLINRFPYFKANKRGWQNSIRHNLSLNKCFTKIPR 183
            :||||||.:|..||||..||:.|.|:.||:::::||||::.|.:.||||:|||||.|.||.||||
Zfish    12 QKPPYSYISLTAMAIQSCPEKMLPLSEIYKFIMDRFPYYRENTQRWQNSLRHNLSFNDCFIKIPR 76

  Fly   184 SYDDPGKGNYWILDPSAEEVFIG-----------------------------ETTGKLRRKNPGA 219
            ..|.||||::|.|.||..::|..                             :...|||....|.
Zfish    77 RPDQPGKGSFWALHPSCGDMFENGSFLRRRKRFKVMISSEHLQKPSDAAHYLQQQAKLRMTALGT 141

  Fly   220 SRTRLAAYRQAIFSPMMAASPYGAP---ASSYGYP-AVPFAAAAAAAL-YQRMNP---------- 269
            ...::.:|..::..|.....|:...   |..|..| ::.|:|..:.:. ||..|.          
Zfish   142 HLPQMTSYNLSVTQPSTFKHPFAIENIIARDYKMPGSLAFSAMHSMSTGYQIHNQLTTAWPHMYS 206

  Fly   270 --------AAYQAAYQQMQY-------------------QQAPQAHHHQAPHPAQMQGYPQQLN 306
                    |||....:.:.:                   ...|..|.|.   ||.:.|.||.|:
Zfish   207 SNVIDAEYAAYGVPLKSLSHGAQSLPAIPVPIKPAPASVPSIPALHAHL---PAFLSGSPQSLS 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 47/84 (56%)
foxb1bNP_571358.2 FH 13..101 CDD:214627 48/87 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.