Sequence 1: | NP_476730.1 | Gene: | slp1 / 33607 | FlyBaseID: | FBgn0003430 | Length: | 322 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_571358.2 | Gene: | foxb1b / 799571 | ZFINID: | ZDB-GENE-990415-77 | Length: | 296 | Species: | Danio rerio |
Alignment Length: | 259 | Identity: | 75/259 - (28%) |
---|---|---|---|
Similarity: | 109/259 - (42%) | Gaps: | 74/259 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 119 KKPPYSYNALIMMAIQDSPEQRLTLNGIYQYLINRFPYFKANKRGWQNSIRHNLSLNKCFTKIPR 183
Fly 184 SYDDPGKGNYWILDPSAEEVFIG-----------------------------ETTGKLRRKNPGA 219
Fly 220 SRTRLAAYRQAIFSPMMAASPYGAP---ASSYGYP-AVPFAAAAAAAL-YQRMNP---------- 269
Fly 270 --------AAYQAAYQQMQY-------------------QQAPQAHHHQAPHPAQMQGYPQQLN 306 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
slp1 | NP_476730.1 | FH | 120..205 | CDD:214627 | 47/84 (56%) |
foxb1b | NP_571358.2 | FH | 13..101 | CDD:214627 | 48/87 (55%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000010 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R2114 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.940 |