DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and foxk2b

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:XP_001922856.1 Gene:foxk2b / 798356 ZFINID:ZDB-GENE-030131-5310 Length:597 Species:Danio rerio


Alignment Length:288 Identity:87/288 - (30%)
Similarity:137/288 - (47%) Gaps:47/288 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 KKPINTATQPIKTEPVHHHHQYVH---PYSNSDGELSASEDFDSPSRTSTPMSSAAESLSSQNND 81
            :.|:......|....::......|   |..:..|.:||:        .|.|.|......|.....
Zfish   123 ESPVKAVQPQISPLTINIPDNIAHLMSPLPSPTGTISAA--------NSCPSSPRGAGSSGYRLG 179

  Fly    82 KL--DVEFDDELEDQLDEDQESEDGNPSKKQKMTAGSDTKKPPYSYNALIMMAIQDSPEQRLTLN 144
            ::  |::..:: ..|.:.|:|:.:|:..|        |..||||||..||:.||..:|:::||||
Zfish   180 RIVPDLQLMND-NSQSENDKETSEGDSPK--------DDSKPPYSYAQLIVQAITMAPDKQLTLN 235

  Fly   145 GIYQYLINRFPYFKANKRGWQNSIRHNLSLNKCFTKIPRSYDDPGKGNYWILDPSAEEVFIGETT 209
            |||.::...:||::...:|||||||||||||:.|.|:|||.::||||::|.:|||:|...:.:..
Zfish   236 GIYTHITKNYPYYRTADKGWQNSIRHNLSLNRYFIKVPRSQEEPGKGSFWRIDPSSEGKLVEQAF 300

  Fly   210 GKLRRKNPGASRTRLA--AYRQAIFSP----MMAASPYG-------------APASSYGYPAVPF 255
            .|.|.:.....||.|.  :.|.|..||    :::|...|             .|..|......|.
Zfish   301 RKRRPRGVPCFRTPLGPLSSRSAPASPNHSGVLSAHSSGVQTPDSLSREGSPVPMESEPVSVPPP 365

  Fly   256 AAAAAAALYQRMNPAAYQAAYQQMQYQQ 283
            ||.|.||:..::      |..|:.::.|
Zfish   366 AAVAVAAVQPKL------AVIQETRFTQ 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 47/84 (56%)
foxk2bXP_001922856.1 FHA 17..109 CDD:238017
Forkhead 211..297 CDD:278670 47/85 (55%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.