DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and foxf1

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001039226.1 Gene:foxf1 / 734087 XenbaseID:XB-GENE-478922 Length:373 Species:Xenopus tropicalis


Alignment Length:355 Identity:95/355 - (26%)
Similarity:140/355 - (39%) Gaps:119/355 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 PSRTSTPMSSAAESLSSQNNDKLDVEFDDELEDQLDEDQESEDGNPSKKQKMT-AG-SDTKKPPY 123
            |...|:|||:|.:....|                   ....|..|.:.|.|.| || ...:||||
 Frog    12 PPAQSSPMSAATDKHGGQ-------------------PSVMESANCATKTKKTNAGIRRPEKPPY 57

  Fly   124 SYNALIMMAIQDSPEQRLTLNGIYQYLINRFPYFKANKRGWQNSIRHNLSLNKCFTKIPRSYDDP 188
            ||.|||:||||.||.:||||:.|||:|.:|||:|:.:.:||:||:|||||||:||.|:|:....|
 Frog    58 SYIALIVMAIQSSPTKRLTLSEIYQFLQSRFPFFRGSYQGWKNSVRHNLSLNECFIKLPKGLGRP 122

  Fly   189 GKGNYWILDPSAEEVFIGETTGKLRRKNPGASR-------------------------------- 221
            |||:||.:||::|.:|   ..|..||:..|..|                                
 Frog   123 GKGHYWTIDPASEFMF---EEGSFRRRPRGFRRKCQALKPMYSMMNGLGFNHIPETYSFQGASGT 184

  Fly   222 -----------------------------------TRLAAYRQAIF------------------S 233
                                               :.:||.....:                  |
 Frog   185 IACPPNSLSLDSGIGMMNGHLPSNVDGMGLSGHPVSHIAANGGHSYMGSCTGSSGGDYSHHDSGS 249

  Fly   234 PMMAASPYGAPASSYGYPAVPFAAAAAAALYQRMNP-----AAYQAAYQQMQYQQAPQAHHHQAP 293
            |::.......|.|.|..||..:|.:|:.. |.:..|     :|.......:......|::.||..
 Frog   250 PLLGGGGVMEPHSVYSSPASAWAPSASTP-YIKQQPLSPCNSAANPLSSSLSSHSLDQSYLHQNS 313

  Fly   294 H--PAQMQGYPQ--QLNAELFQRMQFFGKF 319
            |  .:::||.|:  ..:..:..|.:|...|
 Frog   314 HNTASELQGIPRYHSQSPSMNDRKEFVFSF 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 51/84 (61%)
foxf1NP_001039226.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..51 14/57 (25%)
Forkhead 53..139 CDD:365978 52/88 (59%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 236..255 2/18 (11%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 283..306 2/22 (9%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.