DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and foxq1

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:XP_002934447.2 Gene:foxq1 / 733448 XenbaseID:XB-GENE-483842 Length:437 Species:Xenopus tropicalis


Alignment Length:432 Identity:117/432 - (27%)
Similarity:160/432 - (37%) Gaps:168/432 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 YVHPYSNSDGELSASEDFDSPSRTSTPMSSAAESLSSQN-------NDKL---DVEFD------- 88
            ||.....||.|.|.      ||    |:||..|.|.|..       |..|   |.|.|       
 Frog    11 YVDKVCPSDQEASL------PS----PLSSRGEELGSDGDFVANSPNHVLCPRDCEMDTDTGSLG 65

  Fly    89 -DELEDQLDEDQE--------SEDGNPSKKQKMTAGSDTK------KPPYSYNALIMMAIQDSPE 138
             || ||:::|::|        |.||:...:.::..|..||      ||||||.|||.|||:||..
 Frog    66 GDE-EDEVEEEEEVNPERNGVSADGSTQCRAQIVEGGKTKTYTRRPKPPYSYIALIAMAIKDSAS 129

  Fly   139 QRLTLNGIYQYLINRFPYFKANKRGWQNSIRHNLSLNKCFTKIPRSYDDP-GKGNYWILDPSAEE 202
            .||||..|..||:.:||:|:.:..||:||:|||||||.||.|:.|....| ||.|||:|:|::|.
 Frog   130 GRLTLAEINDYLMKKFPFFRGSYTGWRNSVRHNLSLNDCFVKVLRDPSRPWGKDNYWMLNPNSEY 194

  Fly   203 VFIGETTGKLRRKN------------------------------------------------PGA 219
            .|   ..|..||:.                                                |.:
 Frog   195 TF---ADGVFRRRRKRLNRVTKCLKEQDLQGLAEQQHQMMNPTKASQGSSPSSSRLIMAPSAPSS 256

  Fly   220 SRTRLAAYRQA-------IFSPMMAAS-------------------------PYGA----PASSY 248
            |.|..::.|.|       .||...|..                         |.||    |:|:.
 Frog   257 SSTNSSSNRSAKETNSGTKFSSSFAIESILSKPFQRREREPDPRSSSGRILWPTGALLHSPSSAP 321

  Fly   249 GYPAVPFAAA----AAAALYQRMNPAAYQAAYQQMQY---------------------------- 281
            .||.|.:..:    |.:|||. ::|.|..|:...:|.                            
 Frog   322 SYPIVSYTPSTTLPAPSALYP-ISPLASNASSLHLQLYRYCMPEALLLLMDPRSEGHLSPDPRDD 385

  Fly   282 ---QQAPQAHHHQAPHPAQMQGYPQQL-NAELFQRMQFFGKF 319
               .:.|..|.|....|...:...:|| |.||.:.::..|.:
 Frog   386 QLSHRVPPQHPHLFSPPCSTKTLSEQLGNPELLRTLRTAGAY 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 48/85 (56%)
foxq1XP_002934447.2 FH_FOXQ1-like 111..189 CDD:410808 45/77 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.