DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and foxl2a

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001038717.1 Gene:foxl2a / 692279 ZFINID:ZDB-GENE-060512-241 Length:306 Species:Danio rerio


Alignment Length:263 Identity:88/263 - (33%)
Similarity:125/263 - (47%) Gaps:69/263 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 DELEDQLDEDQESEDGNPSKKQKMTAGSD----TKKPPYSYNALIMMAIQDSPEQRLTLNGIYQY 149
            |......::|:..::..|.|      |.|    |:||||||.|||.|||::|.|:||||:|||||
Zfish    17 DTTSSSAEKDRTKDEAPPEK------GPDKSDPTQKPPYSYVALIAMAIRESSEKRLTLSGIYQY 75

  Fly   150 LINRFPYFKANKRGWQNSIRHNLSLNKCFTKIPRSYDDPGKGNYWILDPSAEEVFIGETTGKLRR 214
            :|::||:::.||:|||||||||||||:||.|:||......|||||.|||:.|::|   ..|..||
Zfish    76 IISKFPFYEKNKKGWQNSIRHNLSLNECFIKVPREGGGERKGNYWTLDPACEDMF---EKGNYRR 137

  Fly   215 KNPGASRTRLAAYRQAIFSPMMAASPYGAPASS------YGYPAVP------------------- 254
                         |:.:..|......:..|..|      |||.:.|                   
Zfish   138 -------------RRRMKRPFRPPPTHFQPGKSLFGGEGYGYLSPPKYLQSGFINNSWSPAPMSY 189

  Fly   255 FAAAAAAALYQRMN------PAAYQAAYQQMQ----------YQQAPQAHHHQAPHPAQMQGYPQ 303
            .:...::.....:|      |::|. .|.::|          |......|||...||..:. :.|
Zfish   190 TSCQVSSGSVSPVNMKGLSAPSSYN-PYSRVQSIGLPSMVNSYNGISHHHHHHHTHPHALP-HAQ 252

  Fly   304 QLN 306
            ||:
Zfish   253 QLS 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 55/84 (65%)
foxl2aNP_001038717.1 Forkhead 46..131 CDD:306709 56/87 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170574870
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.