DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and Foxk2

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:XP_011247520.1 Gene:Foxk2 / 68837 MGIID:1916087 Length:690 Species:Mus musculus


Alignment Length:329 Identity:90/329 - (27%)
Similarity:135/329 - (41%) Gaps:79/329 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 KPINTATQPIKTEPVHHHHQYVHPYSNSDGELSASEDFDSPSRTSTPMSSAAESLSSQNNDKLDV 85
            ||:.....|:...........:.|..:..|.:||:....|..|.:   .|:...:.......|.:
Mouse   203 KPVQPHISPLTINIPDTMAHLISPLPSPTGTISAANSCPSSPRGA---GSSGYKVGRVMPSDLSL 264

  Fly    86 EFDDELEDQLDEDQESEDGNPSKKQKMTAGSDTKKPPYSYNALIMMAIQDSPEQRLTLNGIYQYL 150
            ..|:   .|.:.::|:..|:..|        |..||||||..||:.||..:|:::|||||||.::
Mouse   265 MADN---SQPENEKEASGGDSPK--------DDSKPPYSYAQLIVQAITMAPDKQLTLNGIYTHI 318

  Fly   151 INRFPYFKANKRGWQNSIRHNLSLNKCFTKIPRSYDDPGKGNYWILDPSAEEVFIGETTGKLRRK 215
            ...:||::...:|||||||||||||:.|.|:|||.::||||::|.:||::|...:.:...|.|.:
Mouse   319 TKNYPYYRTADKGWQNSIRHNLSLNRYFIKVPRSQEEPGKGSFWRIDPASESKLVEQAFRKRRPR 383

  Fly   216 ---------------------------------------------------NPGASRTRLAAYRQ 229
                                                               .||||:.:||..::
Mouse   384 GVPCFRTPLGPLSSRSAPASPNHAGVLSAHSSGAQTPESLSREGSPAPLEPEPGASQPKLAVIQE 448

  Fly   230 AIFSPMMAASPYGAPASSYGYPAVPFAAAAAAALYQRMNPAAYQAAYQQMQYQQAP---QAHH-- 289
            |.|    |.|..|:|.||.     |........|...:.|..|..|.........|   |..|  
Mouse   449 ARF----AQSAPGSPLSSQ-----PVLITVQRQLPPAIKPVTYTVATPVTTPTSQPPVVQTVHVV 504

  Fly   290 HQAP 293
            ||.|
Mouse   505 HQIP 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 46/84 (55%)
Foxk2XP_011247520.1 FHA 41..>124 CDD:238017
COG5025 <175..>381 CDD:227358 64/191 (34%)
Forkhead 287..373 CDD:365978 46/85 (54%)
PHA03247 <380..683 CDD:223021 26/138 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.