DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and Foxl1

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:XP_006255788.1 Gene:Foxl1 / 687553 RGDID:1584212 Length:341 Species:Rattus norvegicus


Alignment Length:157 Identity:77/157 - (49%)
Similarity:101/157 - (64%) Gaps:20/157 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 KKPPYSYNALIMMAIQDSPEQRLTLNGIYQYLINRFPYFKANKRGWQNSIRHNLSLNKCFTKIPR 183
            :||||||.|||.|||||:||||:|||||||::::|||::..|::|||||||||||||:||.|:||
  Rat    48 QKPPYSYIALIAMAIQDAPEQRVTLNGIYQFIMDRFPFYHDNRQGWQNSIRHNLSLNECFVKVPR 112

  Fly   184 SYDDPGKGNYWILDPSAEEVFIGETTGKLRRK---------NPGASRTRLAAYRQA-----IFSP 234
            ....||||:||.|||...::|   ..|..||:         :|.|.|||:.. |::     :.||
  Rat   113 EKGRPGKGSYWTLDPRCLDMF---ENGNYRRRKRKPKPAAGSPEAKRTRVEP-RESEVGCDVGSP 173

  Fly   235 MMA-ASPYGAPASSYGYPAVPFAAAAA 260
            .:| |.|...|..|.. ||....|.:|
  Rat   174 NLATARPMHEPDRSQS-PAAGGTARSA 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 56/84 (67%)
Foxl1XP_006255788.1 FH 49..137 CDD:214627 57/90 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.