DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and FOXL2

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_075555.1 Gene:FOXL2 / 668 HGNCID:1092 Length:376 Species:Homo sapiens


Alignment Length:283 Identity:96/283 - (33%)
Similarity:120/283 - (42%) Gaps:99/283 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 QESEDGNPSKKQKMTAGSDT--------KKPPYSYNALIMMAIQDSPEQRLTLNGIYQYLINRFP 155
            :|.|...||..:....|..|        :||||||.|||.|||::|.|:||||:|||||:|.:||
Human    25 KEPEGPPPSPGKGGGGGGGTAPEKPDPAQKPPYSYVALIAMAIRESAEKRLTLSGIYQYIIAKFP 89

  Fly   156 YFKANKRGWQNSIRHNLSLNKCFTKIPRSYDDPGKGNYWILDPSAEEVFIGETTGKLRRK----- 215
            :::.||:|||||||||||||:||.|:||......|||||.|||:.|::|   ..|..||:     
Human    90 FYEKNKKGWQNSIRHNLSLNECFIKVPREGGGERKGNYWTLDPACEDMF---EKGNYRRRRRMKR 151

  Fly   216 ---------NPGASRTRLAAYRQAIFSPMMAA---SPYGAPASSYGYPAVP-------------- 254
                     .||          :.:|....||   ...||.|..|||.|.|              
Human   152 PFRPPPAHFQPG----------KGLFGAGGAAGGCGVAGAGADGYGYLAPPKYLQSGFLNNSWPL 206

  Fly   255 -------------FAAAAAAA-----------------LYQRMNPAAYQAAYQQMQYQ------- 282
                         .|||||||                 :.....|||....|.::|..       
Human   207 PQPPSPMPYASCQMAAAAAAAAAAAAAAGPGSPGAAAVVKGLAGPAASYGPYTRVQSMALPPGVV 271

  Fly   283 ----------QAPQAHHHQAPHP 295
                      .||....|..|||
Human   272 NSYNGLGGPPAAPPPPPHPHPHP 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 55/84 (65%)
FOXL2NP_075555.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..53 6/27 (22%)
Forkhead 53..139 CDD:365978 56/88 (64%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 276..342 6/19 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141960
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.