DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and FOXD4L6

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001078945.1 Gene:FOXD4L6 / 653404 HGNCID:31986 Length:417 Species:Homo sapiens


Alignment Length:286 Identity:93/286 - (32%)
Similarity:124/286 - (43%) Gaps:84/286 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 STPMSSAAESLSSQNNDKLDVEFDDELEDQLDEDQESED-------------------------- 103
            |||..|..:  |...:.|:||..::|.||::::::|:..                          
Human    11 STPQRSLRD--SDGEDGKIDVLGEEEDEDEVEDEEEAASQQFLEQSLQPGLQVARWGGVALPREH 73

  Fly   104 ----GNPSKKQKM-----------TAGSDTK---KPPYSYNALIMMAIQDSPEQRLTLNGIYQYL 150
                |.||...:.           .|..|.:   ||||||.|||.|||..:|.:||||:||..::
Human    74 IEGGGGPSDPSEFGTKFRAPPRSAAASEDARQPAKPPYSYIALITMAILQNPHKRLTLSGICAFI 138

  Fly   151 INRFPYFKANKRGWQNSIRHNLSLNKCFTKIPRSYDDPGKGNYWILDPSAEEVFIGETTGKLRRK 215
            ..||||::.....||||||||||||.||.||||....|||||||.|||:::::|  :....|||:
Human   139 SGRFPYYRRKFPAWQNSIRHNLSLNDCFVKIPREPGHPGKGNYWSLDPASQDMF--DNGSFLRRR 201

  Fly   216 --------NPGASRTR---LAAYRQAIFSPMMAASPYGAPASSYGYPAVPFAAAAAAALYQRMNP 269
                    .|||....   |.|...|:.:|        .|....|.||.|             .|
Human   202 KRFKRHQLTPGAHLPHPFPLPAAHAALHNP--------HPGPLLGAPAPP-------------QP 245

  Fly   270 AAYQAAYQQMQYQQAPQAHHHQAPHP 295
            .  ..||......:.|.|..|  |||
Human   246 V--PGAYPNTAPGRRPYALLH--PHP 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 51/84 (61%)
FOXD4L6NP_001078945.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..50 12/40 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 70..105 5/34 (15%)
Forkhead 108..194 CDD:278670 52/87 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.