DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and Foxq1

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_074049.2 Gene:Foxq1 / 64826 RGDID:621572 Length:400 Species:Rattus norvegicus


Alignment Length:255 Identity:85/255 - (33%)
Similarity:115/255 - (45%) Gaps:62/255 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 SDGELSASEDFDSPSRTSTPMSSAAESLSSQNNDKLDVEFD------------DELEDQLDEDQE 100
            ||.|.:.|.|..||             ||:..:|.|..:.|            .:||....|...
  Rat    18 SDLEGAGSSDVPSP-------------LSAAGDDSLGSDGDCAANSPAAGRGAVDLEGGGGERNS 69

  Fly   101 SEDGNPSKKQKMTAGSDTK--------------------------KPPYSYNALIMMAIQDSPEQ 139
            |...:.....::|.||.|:                          ||||||.|||.|||:||...
  Rat    70 SGGASTQDDPEVTDGSRTQASPVGPCAGSVGGGEGARSKPYTRRPKPPYSYIALIAMAIRDSAGG 134

  Fly   140 RLTLNGIYQYLINRFPYFKANKRGWQNSIRHNLSLNKCFTKIPRSYDDP-GKGNYWILDPSAEEV 203
            ||||..|.:||:.:||:|:.:..||:||:|||||||.||.|:.|....| ||.|||:|:|::|..
  Rat   135 RLTLAEINEYLMGKFPFFRGSYTGWRNSVRHNLSLNDCFVKVLRDPSRPWGKDNYWMLNPNSEYT 199

  Fly   204 FIGETTGKLRRKNPGAS-RTRLAA--YRQAIFSPMMAASPYGAPASSYGYPAVPFAAAAA 260
            |   ..|..||:....| ||.::|  .|.....|..|.:|..||.:.    :.|.|.:.|
  Rat   200 F---ADGVFRRRRKRLSHRTTVSASGLRPEEAPPGPAGTPQPAPTAG----SSPIARSPA 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 48/85 (56%)
Foxq1NP_074049.2 FH 115..193 CDD:238016 45/77 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.