DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and Foxb1

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_071773.2 Gene:Foxb1 / 64290 MGIID:1927549 Length:325 Species:Mus musculus


Alignment Length:217 Identity:80/217 - (36%)
Similarity:108/217 - (49%) Gaps:45/217 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 KKPPYSYNALIMMAIQDSPEQRLTLNGIYQYLINRFPYFKANKRGWQNSIRHNLSLNKCFTKIPR 183
            :||||||.:|..||||.|||:.|.|:.||:::::||||::.|.:.||||:|||||.|.||.||||
Mouse    12 QKPPYSYISLTAMAIQSSPEKMLPLSEIYKFIMDRFPYYRENTQRWQNSLRHNLSFNDCFIKIPR 76

  Fly   184 SYDDPGKGNYWILDPSAEEVFIGETTGKLRRK--------------NPG--------ASRTRLAA 226
            ..|.||||::|.|.||..::|  |....|||:              .|.        .::.||:|
Mouse    77 RPDQPGKGSFWALHPSCGDMF--ENGSFLRRRKRFKVLKSDHLAPSKPADAAQYLQQQAKLRLSA 139

  Fly   227 Y-RQAIFSPMMAASPY--GAPASSYGYPAVPFAAAAAAALYQRMNPAAYQAAYQQMQYQQAPQAH 288
            . ......|.|.|:.|  |..|...|:.. |||.....|...:| |..  .|:..|  |..|.|:
Mouse   140 LAASGTHLPQMPAAAYNLGGVAQPSGFKH-PFAIENIIAREYKM-PGG--LAFSAM--QPVPAAY 198

  Fly   289 HHQAPHPAQM--------QGYP 302
                |.|.|:        .|:|
Mouse   199 ----PLPNQLTTMGSSLGTGWP 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 48/84 (57%)
Foxb1NP_071773.2 FH 13..101 CDD:214627 50/89 (56%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 284..325
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.