DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and Foxj2

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_068699.1 Gene:Foxj2 / 60611 MGIID:1926805 Length:565 Species:Mus musculus


Alignment Length:297 Identity:87/297 - (29%)
Similarity:113/297 - (38%) Gaps:102/297 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 SEDGNPSKKQKMTAGSDTK----------------KPPYSYNALIMMAIQDSPEQRLTLNGIYQY 149
            |:.|.|...:|.:.||.|.                ||.|||..||..||..||.:::||:.||::
Mouse    31 SQAGPPGGARKCSPGSPTDPNATLSKDEAAVHQDGKPRYSYATLITYAINSSPAKKMTLSEIYRW 95

  Fly   150 LINRFPYFKANKRGWQNSIRHNLSLNKCFTKIPRSYDDPGKGNYWILDPSAEEVFIGETTGKLRR 214
            :.:.|||:|....||:|||||||||||||.|:||..||||||:||.:|...:       ..:.||
Mouse    96 ICDNFPYYKNAGIGWKNSIRHNLSLNKCFRKVPRPRDDPGKGSYWTIDTCPD-------ISRKRR 153

  Fly   215 KNPGASRTRLAAYRQAIFSP-------------------MMAASPYGAPASSYGYPAVPFAAAAA 260
            ..|....::.:..::|..||                   |...||......|.|..:|...|.||
Mouse   154 HPPDDDLSQDSPEQEASKSPRGGVPGSGEASLSHEGTPQMSLQSPSSVANYSQGPGSVDGGAVAA 218

  Fly   261 AA-------------------------------------LYQR------------------MNPA 270
            .|                                     ||:.                  |.|:
Mouse   219 GAPGQESTEGAPPLYNTNHDFKFSYSEINFQDLSWSFRNLYKSMLERSSSSQHGFSSLLGDMPPS 283

  Fly   271 AYQAAYQQMQYQQAPQAHHHQAPHPAQMQGYPQQLNA 307
            .....|||.|.||.|     ..|.|...|..|||..|
Mouse   284 NNYYVYQQQQQQQPP-----PQPQPPPQQPQPQQQQA 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 46/84 (55%)
Foxj2NP_068699.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 29..61 7/29 (24%)
Forkhead 66..143 CDD:278670 45/76 (59%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 125..233 28/114 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 290..399 13/31 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 543..565
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.