DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and Foxm1

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_113821.2 Gene:Foxm1 / 58921 RGDID:61807 Length:771 Species:Rattus norvegicus


Alignment Length:271 Identity:76/271 - (28%)
Similarity:116/271 - (42%) Gaps:59/271 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 LSSQNNDKLD-VEFDDELEDQ----LDEDQESEDGNPSKKQKMTAGSDTKKPPYSYNALIMMAIQ 134
            |...::|.|. .....|||::    |::::...:. ||:.......|.:::|||||.|:|..||.
  Rat   186 LGKMSSDGLGRCSIKQELEEKENCHLEQNRVKVEA-PSRASVSWQDSVSERPPYSYMAMIQFAIN 249

  Fly   135 DSPEQRLTLNGIYQYLINRFPYFK-ANKRGW------------QNSIRHNLSLNKCFTKIPRSYD 186
            .:..:|:||..||.::.:.||||| ..|.||            ||||||||||:..|.   |...
  Rat   250 STERKRMTLKDIYTWIEDHFPYFKHIAKPGWKCWHQAYHKLGPQNSIRHNLSLHDMFV---RETS 311

  Fly   187 DPGKGNYWILDPSA------EEVFIGETTG----------KLRRKNPGASR-----TRLAAYRQA 230
            ..||.::|.:.|||      ::||.....|          :.:|.||...|     |.|....:.
  Rat   312 ANGKVSFWTIHPSANRYLTLDQVFKPLEPGSPQSPEHLESQQKRPNPELRRNVTIKTELPLGARR 376

  Fly   231 IFSPMM-AASPYGAP------ASSYGYPAVPFAAAAAAALYQRMNPAAYQAAYQQMQYQQAPQ-- 286
            ...|:: ..|.|..|      .|....|:|......||:|      .:.:.|....:.:.||:  
  Rat   377 KMKPLLPRVSSYLVPIQFPVNQSLVLQPSVKVPLPLAASL------MSSELARHSKRVRIAPKVL 435

  Fly   287 -AHHHQAPHPA 296
             ::...||.||
  Rat   436 LSNEGIAPLPA 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 41/103 (40%)
Foxm1NP_113821.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..54
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 94..165
FH 235..322 CDD:238016 37/89 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 340..361 4/20 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 542..568
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 584..655
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 693..718
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.